Biotinylated Recombinant Human Dual Specificity Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06593P

Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Human Dual Specificity Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06593P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Human Dual Specificity Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P46734 |
Target Symbol | MAP2K3 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS |
Expression Range | 1-347aa |
Protein Length | Full Length |
Mol. Weight | 87.1 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14. |
Protein Families | Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily |
Database References | |
Associated Diseases | Defects in MAP2K3 may be involved in colon cancer. |
Tissue Specificity | Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues. |
Gene Functions References
- Advanced glycation end products significantly activated ASK1, MKK3, and MKK6, which led to activation of p38 MAPK, resulting in upregulated fibrotic response in human coronary smooth muscle cells. PMID: 30305582
- The study identifies MKK3 as a negative regulator of mitochondrial function and inflammatory responses to cigarette smoke and suggests that MKK3 could be a therapeutic target. PMID: 27717867
- High MKK3 expression is associated with lung cancer. PMID: 28628118
- miR-21 targets MKK3 in vivo and in vitro, inhibiting the downstream factors IL-6 and TNF-alpha, in ischemia pretreatment protection from ischemia-reperfusion induced kidney injury. PMID: 26149640
- MKK3 overexpression upregulated the cyclin-dependent kinase inhibitors, p16 INK4A and p15 INK4B in hepatocellular carcinoma cells was Bim1, was downregulated following MKK3 overexpression. PMID: 26573508
- Our results suggest that asthma is associated with MKK3 over-expression in CD8+ cells; we have also demonstrated that MKK3 may be critical for airway neutrophilia PMID: 24480516
- MicroRNA-21 promotes hepatocellular carcinoma HepG2 cell proliferation through repression of mitogen-activated protein kinase-kinase 3. PMID: 24112539
- study detected higher MKK3 activation in isolated peripheral blood mononuclear cells from septic patients compared with nonseptic controls PMID: 24487387
- study concludes MAP2K3 is a reproducible obesity locus that may affect body weight via complex mechanisms involving appetite regulation and hypothalamic inflammation PMID: 23825110
- miR-20a acts in a feedback loop to repress the expression of MKK3 and to negatively regulate the p38 pathway-mediated VEGF-induced endothelial cell migration and angiogenesis PMID: 22696064
- the balance between MKK6 and MKK3 mediates p38 MAPK associated resistance to cisplatin in NSCLC PMID: 22164285
- LFA-1-induced stabilization of ARE-containing mRNAs in T cells is dependent on HuR, and occurs through the Vav-1, Rac1/2, MKK3 and p38MAPK signaling cascade PMID: 21206905
- MAP2K3 is identified as a protein to promote senescence in human breast epithelial cells. PMID: 21137025
- Data provide evidence that p38 Map kinase (MAPK) pathway is activated leading to increased upregulation of mixed lineage kinase 3, MKK3/6, MSK1, and Mapkapk2, upon treatment of BCR/ABL expressing cells with dasatinib. PMID: 19672773
- role in activating Mirk protein kinase PMID: 11980910
- interacts with phospholipase c-beta 2 PMID: 12054652
- role in pathway that promotes urokinase plasminogen activator mRNA stability in invasive breast cancer cells PMID: 12377770
- TAK1- and MKK3-mediated activation of p38 are facilitated by Smad7 PMID: 12589052
- MKK3 is selectively activated by the new subfamily of Ste20-like kinases. PMID: 13679851
- a specific requirement for p150(Glued)/dynein/functional microtubules in activation of MKK3/6 and p38 MAPKs in vivo. PMID: 15375157
- MAP kinase kinase3- and 6-dependent activation of the alpha-isoform of p38 MAP kinase is required for the cytoskeletal changes induced by neutrophil adherence and influences subsequent neutrophil migration toward endothelial cell junctions PMID: 15516490
- H-Ras-specific activation of Rac-MKK3/6-p38 pathway has a role in invasion and migration of breast epithelial cells PMID: 15677464
- MKK3 and MKK6 make individual contributions to p38 activation in fibroblast-like synoviocytes after cytokine stimulation PMID: 15778394
- p38 mediates EGF receptor activation after oxidant injury; Src activates MMK3, which, in turn, activates p38; and the EGF receptor signaling pathway plays a critical role in renal epithelial cell dedifferentiation PMID: 15797859
- Bax is phosphorylated by stress-activated JNK and/or p38 kinase and phosphorylation of Bax leads to mitochondrial translocation prior to apoptosis PMID: 16709574
- Mitogen-activated protein kinase (MAPK) kinase 3 (MKK3) is a key activator of p38 MAPK in glioma; MKK3 activation is strongly correlated with p38 activation in vitro and in vivo. PMID: 17406030
- Cytokine activation of MAPK14 and apoptosis is opposed by ACTN4 targeting of protein phosphatase 2A for site-specific dephosphorylation of MEK3. PMID: 17438131
- as a mediator of SF- and Src-stimulated NF-kappaB activity. Finally, the Src/Rac1/MKK3/6/p38 and Src/TAK1/NF-kappaB-inducing kinase pathways exhibited cross-talk at the level of MKK3. PMID: 19047046