Biotinylated Recombinant Human Kita-Kyushu Lung Cancer Antigen 1 (CT83) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06792P

Greater than 90% as determined by SDS-PAGE.
Biotinylated Recombinant Human Kita-Kyushu Lung Cancer Antigen 1 (CT83) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06792P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Human Kita-Kyushu Lung Cancer Antigen 1 (CT83) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q5H943 |
Target Symbol | CT83 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
Expression Range | 22-113aa |
Protein Length | Partial |
Mol. Weight | 58.1 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Subcellular Location | Cell membrane; Single-pass type II membrane protein. |
Database References | |
Tissue Specificity | Specifically expressed in testis. Expressed by cancer cell lines. |
Gene Functions References
- High KK-LC-1 expression was detected in breast cancer, especially in oestrogen receptor-negative subtypes. PMID: 30275220
- The KK-LC-1 expression rate was high even in patients with stage I cancer, suggesting that KK-LC-1 is a useful biomarker for early diagnosis of gastric cancer. PMID: 29290656
- KK-LC-1 was frequently expressed in gastric cancer caused by H. pylori infection. PMID: 28438869
- CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer. PMID: 26327325
- The frequency of KK-LC-1 expression was higher than that of the other CTAs. KK-LC-1 might be a useful target for immunotherapy and in diagnosis of gastric cancer. PMID: 26026129