Recombinant E. coli Nitroreductase Protein
Beta LifeScience
SKU/CAT #: BLA-3723P
Recombinant E. coli Nitroreductase Protein
Beta LifeScience
SKU/CAT #: BLA-3723P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Escherichia coli |
Accession | P38489 |
Synonym | Dihydropteridine reductase dprA FMN dependent nitroreductase nfnB nfsI ntr Oxygen insensitive NAD(P)H nitroreductase |
Description | Recombinant E. coli Nitroreductase Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMDIISVALKRHSTKAFDASKKLTPEQAEQI KTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASH VVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRK DLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV |
Molecular Weight | 26 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |