Recombinant Human Group Xiia Secretory Phospholipase A2 (PLA2G12A) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11161P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Group Xiia Secretory Phospholipase A2 (PLA2G12A) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11161P
Regular price
$1,25600
$1,256.00
Sale price$34900
$349.00Save $907
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Group Xiia Secretory Phospholipase A2 (PLA2G12A) Protein (His&Myc) is produced by our expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9BZM1 |
Target Symbol | PLA2G12A |
Synonyms | EC 3.1.1.4 ; Group XII secreted phospholipase A2; Group XIIA secreted phospholipase A2; Group XIIA secretory phospholipase A2; Group XIIA secretory phospholipase A2 precursor ; GXII; GXII sPLA2; PG12A_HUMAN; phosphatidylcholine 2 acylhydrolase 12A; Phosphatidylcholine 2 acylhydrolase GXII ; Phosphatidylcholine 2-acylhydrolase 12A; Phospholipase A2 group XIIA; PLA2G12 ; Pla2g12a; ROSSY; sPLA2 XII; sPLA2-XII |
Species | Homo sapiens (Human) |
Tag | N-10His&C-Myc |
Target Protein Sequence | QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL |
Expression Range | 23-189aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 22.6 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. |
Subcellular Location | Secreted. Cytoplasm. |
Protein Families | Phospholipase A2 family |
Database References | |
Tissue Specificity | Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas. |
Gene Functions References
- The study demonstrated that PLA2G12A SNPs or haplotypes might influence the susceptibility to schizophrenia in the Han Chinese population from Northeast China. PMID: 27434078
- cellular arachidonate (AA) release and prostaglandin (PG) production are regulated by novel classes of secretory phospholipase A(2)s (sPLA(2)s), groups III and XII PMID: 12522102