Recombinant Human Group Xiia Secretory Phospholipase A2 (PLA2G12A) Protein (His&Myc)

Name: Recombinant Human Group Xiia Secretory Phospholipase A2 (PLA2G12A) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-11161P
Price: 299.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Price Save $957

Size

100ug

Product Overview

Description	Recombinant Human Group Xiia Secretory Phospholipase A2 (PLA2G12A) Protein (His&Myc) is produced by our expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9BZM1
Target Symbol	PLA2G12A
Synonyms	EC 3.1.1.4 ; Group XII secreted phospholipase A2; Group XIIA secreted phospholipase A2; Group XIIA secretory phospholipase A2; Group XIIA secretory phospholipase A2 precursor ; GXII; GXII sPLA2; PG12A_HUMAN; phosphatidylcholine 2 acylhydrolase 12A; Phosphatidylcholine 2 acylhydrolase GXII ; Phosphatidylcholine 2-acylhydrolase 12A; Phospholipase A2 group XIIA; PLA2G12 ; Pla2g12a; ROSSY; sPLA2 XII; sPLA2-XII
Species	Homo sapiens (Human)
Tag	N-10His&C-Myc
Target Protein Sequence	QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL
Expression Range	23-189aa
Protein Length	Full Length of Mature Protein
Mol. Weight	22.6 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.
Subcellular Location	Secreted. Cytoplasm.
Protein Families	Phospholipase A2 family
Database References	HGNC: 18554 OMIM: 611652 KEGG: hsa:81579 STRING: 9606.ENSP00000243501 UniGene: Hs.389452
Tissue Specificity	Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas.

Gene Functions References

The study demonstrated that PLA2G12A SNPs or haplotypes might influence the susceptibility to schizophrenia in the Han Chinese population from Northeast China. PMID: 27434078
cellular arachidonate (AA) release and prostaglandin (PG) production are regulated by novel classes of secretory phospholipase A(2)s (sPLA(2)s), groups III and XII PMID: 12522102

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.