Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10992P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10992P
Regular price
$1,47800
$1,478.00
Sale price$29900
$299.00Save $1,179
/
Product Overview
Description | Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P08861 |
Target Symbol | CELA3B |
Synonyms | CELA3B; ELA3B; Chymotrypsin-like elastase family member 3B; EC 3.4.21.70; Elastase IIIB; Elastase-3B; Protease E |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His |
Target Protein Sequence | VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH |
Expression Range | 29-270aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 28.8 |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Efficient protease with alanine specificity but only little elastolytic activity. |
Protein Families | Peptidase S1 family, Elastase subfamily |
Database References | |
Tissue Specificity | Pancreas. Not detectable in keratinocytes. |
Gene Functions References
- The aim of this study was to examine the frequency of exocrine dysfunctions of the pancreas according to the level of fecal elastase-1 (FE-1) in patients with diabetes mellitus, type 1 and diabetes mellitus, type 2. PMID: 30106003
- this study demonstrated a strong association of diabetes with low pancreatic elastase levels in feces PMID: 27069032
- The results of the study suggest that the levels of apelin, TNF-alpha and elastase-1 are important diagnostic markers of CP in patients with type 2 diabetes mellitus. PMID: 26817104
- Recombinant type I pancreatic elastase improves unassisted arteriovenous fistula maturation in hemodialysis patients. PMID: 24684771
- A low value of faecal elastase-1, indicating reduced exocrine pancrease secretion, is strongly correlated with a poor survival in advanced pancreatic cancer. PMID: 22749648
- FE-1 is a poor surrogate for diagnosing impaired fat absorption. PMID: 22094930
- Hypermethylation of ELA3B gene promoter were associated with pancreatic cancer. PMID: 20428826
- As an independent variable, correlated with C-peptide and HBA1c levels in type 1 diabetes. PMID: 15277440
- pancreatic elastase induced proinflammatory effects are mediated by TLR4 and NF-kappaB in human myeloid cells PMID: 15351720
- Patients with type 1 diabetes and low fecal elastase 1 concentrations were succesfully treatted with pancretin. PMID: 17103488
- Fecal fat excretion is increased in patients with type 2 diabetes with fecal elastase deficiency. PMID: 17989309
- Neither low fecal elastase 1 nor raised fecal fat levels reliably indicate exocrine pancreatic insufficiency in type-1 diabetes. PMID: 18362841
- Reduced fecal elastase 1 connected with lowered serum levels of vitamin D3 is associated with osteoporotic bone fractures. PMID: 18424365
- Parathormone levels and Vitamin D metabolism in female patients with various grades of fecal ELA1 deficiency are reported. PMID: 19073396