Recombinant Human Adenine Nucleotide Translocator 2/ANT2 Protein
Beta LifeScience
SKU/CAT #: BLA-2622P
Recombinant Human Adenine Nucleotide Translocator 2/ANT2 Protein
Beta LifeScience
SKU/CAT #: BLA-2622P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 2F1 AAC2 Adenine nucleotide translocator 2 ADP ADP ATP carrier protein 2 ADP/ATP translocase 2 ADT2_HUMAN ANT 2 ANT2 ATP carrier protein ATP carrier protein 2 fibroblast isoform OTTHUMP00000024324 SLC25A5 Solute carrier family 25 (mitochondrial carrier adenine nucleotide translocator) member 5 Solute carrier family 25 member 5 T2 T3 |
Description | Recombinant Human Adenine Nucleotide Translocator 2/ANT2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQ YKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFL GGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGA EREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKG MLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIM YTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |