Recombinant Human alpha 2 Macroglobulin / A2M Protein
Beta LifeScience
SKU/CAT #: BLA-12095P
Recombinant Human alpha 2 Macroglobulin / A2M Protein
Beta LifeScience
SKU/CAT #: BLA-12095P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | A2m A2MG_HUMAN Alpha 2 M Alpha 2M Alpha-2-M Alpha-2-macroglobulin C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5 CPAMD5 DKFZp779B086 FWP007 S863 7 |
Description | Recombinant Human alpha 2 Macroglobulin / A2M Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCP QLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |