Recombinant Human alpha A Crystallin/CRYAA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-12098P
Recombinant Human alpha A Crystallin/CRYAA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-12098P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P02489 |
Synonym | Acry 1 Alpha crystallin A chain Alpha-crystallin A chain CRYA 1 CRYA1 CRYAA CRYAA_HUMAN Crystallin alpha 1 Crystallin alpha A Heat shock protein beta 4 Heat shock protein beta-4 HSPB 4 HspB4 short form Zonular Central Nuclear Cataract |
Description | Recombinant Human alpha A Crystallin/CRYAA Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQ SLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKH NERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGL DATHAERAIPVSREEKPTSAPSS |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |