Recombinant Human AMACR Protein
Beta LifeScience
SKU/CAT #: BLA-12116P
Recombinant Human AMACR Protein
Beta LifeScience
SKU/CAT #: BLA-12116P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 2 arylpropionyl CoA epimerase 2 methylacyl CoA racemase 2-methylacyl-CoA racemase Alpha methylacyl CoA racemase Alpha methylacyl Coenzyme A racemase Alpha methylacyl-CoA racemase deficiency, included Alpha-methylacyl-CoA racemase Amacr AMACR deficiency, included AMACR_HUMAN CBAS4 Da1-8 EC 5.1.99.4 Macr1 Methylacyl CoA racemase alpha RACE RM |
Description | Recombinant Human AMACR Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGK RSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENP RLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESV GSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |