Recombinant Human Angiotensin II Type 1 Receptor / AGTR1 Protein
Beta LifeScience
SKU/CAT #: BLA-12150P
Recombinant Human Angiotensin II Type 1 Receptor / AGTR1 Protein
Beta LifeScience
SKU/CAT #: BLA-12150P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | AG2S Agtr 1 Agtr1 AGTR1_HUMAN Agtr1a AGTR1B Ang II Angiotensin II receptor type 1 Angiotensin II type-1 receptor Angiotensin receptor 1 Angiotensin receptor 1B AT 1B AT 1r AT1 At1a AT1AR AT1B AT1BR AT1R AT2R1 AT2R1A AT2R1B HAT1R Type 1 angiotensin II receptor Type 1B angiotensin II receptor Type-1 angiotensin II receptor |
Description | Recombinant Human Angiotensin II Type 1 Receptor / AGTR1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNP LFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSST KKPAPCFEVE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |