Recombinant Human Ankyrin-3 (ANK3) Protein (hFc)

Name: Recombinant Human Ankyrin-3 (ANK3) Protein (hFc)
Brand: Beta LifeScience
SKU: BLC-06752P
Price: 349.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins holiday sale

Price Save $1,406

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Ankyrin-3 (ANK3) Protein (hFc) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q12955
Target Symbol	ANK3
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG
Expression Range	4088-4199aa
Protein Length	Partial
Mol. Weight	41.5 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	In skeletal muscle, required for costamere localization of DMD and betaDAG1. Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments. Regulates KCNA1 channel activity in function of dietary Mg(2+) levels, and thereby contributes to the regulation of renal Mg(2+) reabsorption.; May be part of a Golgi-specific membrane cytoskeleton in association with beta-spectrin.
Subcellular Location	Cytoplasm, cytoskeleton. Cell projection, axon. Cell membrane, sarcolemma. Cell junction, synapse, postsynaptic cell membrane. Lysosome. Cell membrane, sarcolemma, T-tubule.; [Isoform 5]: Cytoplasm, cytoskeleton. Golgi apparatus.
Database References	HGNC: 494 OMIM: 600465 KEGG: hsa:288 STRING: 9606.ENSP00000280772 UniGene: Hs.499725
Associated Diseases	Mental retardation, autosomal recessive 37 (MRT37)
Tissue Specificity	Expressed in brain, neurons, muscles and other tissues.

Gene Functions References

Polymorphism in ANK3 gene is associated with Fetal Alcohol Spectrum Disorders. PMID: 29109170
an association between ANK3 rs10994336, rs10994338, rs4948418 and rs958852 and schizophrenia risk in a northern Chinese Han population. PMID: 27811378
The combination of tract-based spatial statistics (TBSS) with genotyping can be powerful to unveil the role of white matter in bipolar disorder, in conjunction with risk genes, ANK3 and ZNF804A. PMID: 28648753
A significant association was found between bipolar disorder and rs10994336 (OR=1.18; 95% confidence interval: 1.06-1.31; P=0.0027) as well as rs1938526 (OR=1.16; 95% confidence interval: 1.06-1.28; P=0.0016) in ANK3. PMID: 29068871
Thus ANK3's important association with human bipolar susceptibility may arise from imbalance between AnkG function in interneurons and principal cells and resultant excessive circuit sensitivity and output. PMID: 27956739
ANK3 expression is associated with androgen receptor stability, invasiveness, and lethal outcome in prostate cancer patients. PMID: 27534968
Nonsense mutation in ANK3 was identified in a patient with speech impairment, intellectual disability and autistic features. PMID: 28687526
Decreases in UF FA were observed among BD subjects carrying the ANK3 rs9804190 risk allele (T), compared to CC and T-carrier control subjects and BD CC homozygotes. PMID: 27240527
we found significant associations between rs10994336 and the N170 during the facial affect processing across two independent samples of healthy adults. In both samples, the risk allele carriers (TT/TC) consistently showed reduced N170. Our result showed clear evidence that rs10994336 may impact on the early neural processes (as reflected in N170) of facial affect processing. PMID: 27177275
This study identified a SNP in ANK3 with a strong protective effect for Bipolar Disorder and Schizophrenia. PMID: 26682468
The haplotype analysis results suggest that ANK3 variants rs1938526 and rs10994336 may confer susceptibility for BD in the Korean population. Association analysis revealed a probable genetic difference between Korean and Caucasian populations in the degree of ANK3 involvement in BD pathogenesis. PMID: 28079488
The ankyrin 3 genotype may be associated with pathogenesis of age-related neurodegeneration, and, in part, of bipolar disorder. PMID: 27488254
Whole-exome sequencing in ASD patients from each family identified a second rare inherited genetic variant, affecting either the ANK3 genes encoding NLGN4X interacting proteins expressed in inhibitory or in excitatory synapses. PMID: 26055424
we investigated the association of CACNA1C and ANK3 with SZ using meta-analytic techniques. PMID: 26227746
ankyrin-G associates with and inhibits the endocytosis of VE-cadherin cis dimers. PMID: 26574545
ANK3 rs10761482 showed a significant association with bipolar disorder PMID: 25311363
ANK3 bipolar-risk polymorphisms are associated with hyperactivation in the ventral anterior cingulate cortex in bipolar disorder. PMID: 25711502
Phosphorylation of KCNQ2 and KCNQ3 anchor domains by protein kinase CK2 augments binding to AnkG. PMID: 25998125
Data suggest that death domain of ankyrin G (ANK3-DD; located near C-terminus) exhibits C-terminal tail that curves back so that aromatic ring of a phenylalanine residue anchors flexible tail onto core domain; ANK3-DD exists as monomer in solution. PMID: 25307106
Here, we show that ANK3 gene expression in blood is significantly increased in bipolar disorder and schizophrenia compared with healthy controls. PMID: 24809399
Kidney AE1 actually associates with epithelial ankyrin-G and renal ammonium transporter RhBG, which also binds ankyrin-G. PMID: 25616663
This study demonistrated that ANK3 Bipolar disorder-associated variant rs139972937, responsible for an asparagine to serine. change (p = 0.042). PMID: 24716743
Study showed a significant association between LMAN2L and risk of both bipolar disorder and schizophrenia PMID: 24914473
ANK3 risk allele rs1938526 appears to be associated with general cognitive impairment and widespread cortical thinning in patients with first-episode psychosis PMID: 24016415
These resultsindicatethatariskvariantwithin ANK3 may have an impact on neurocog- nitive function,suggesting a mechanism by which ANK3 confers risk for bipolar disorder. PMID: 24655771
results indicated that genetic variation within ANK3 may exert gene-specific modulating effects onworking memory deficits in schizophrenia. PMID: 24361380
A role of ANK3 in risk of stress-related and externalizing disorders, beyond its previous associations with bipolar disorder and schizophrenia. PMID: 23796624
These findings suggest a brain-specific cis-regulatory transcriptional effect of ANK3 that may be relevant to BD pathophysiology. PMID: 22850628
data established a role for ankG in the human adaptive immune response against resident brain proteins, and they show that ankG immunization reduces brain beta-amyloid and its related neuropathology PMID: 22688190
ANK3 SNP associated with brain connectivity changes in bipolar disorder. PMID: 24108394
haplotype associated with bipolar disorder in Latino populations PMID: 23715300
inactivating mutations in the Ankyrin 3 (ANK3) gene in patients with severe cognitive deficits. PMID: 23390136
study concludes that ANK3 gene has a major influence on susceptibility to schizophrenia across populations PMID: 23109352
An association between ANK3 mutations and autism spectrum disorder susceptibility. PMID: 22865819
show novel expression of genes near regions of significantly associated SNPS, including TMEM26 and FOXA1 in airway epithelium and lung parenchyma, and ANK3 in alveolar macrophages in COPD PMID: 22986903
Cysteine 70 of ankyrin-G is S-palmitoylated and is required for function of ankyrin-G in membrane domain assembly. PMID: 23129772
The findings of this study do not support a strong genetic link between bipolar disorder and major depressive disorder for ANK3 genes. PMID: 22647524
Individuals carrying the bipolar disorder risk T-allele of ANK3 showed significantly reduced sensitivity in target detection, increased errors of commission, and atypical response latency variability. PMID: 22498896
DNA sequencing revealed a novel low frequency (0.007) ANK3 SNP (ss469104599) which causes a non-conservative amino acid change at position 794 in the shorter isoforms of the ankyrin G protein. PMID: 22328486
loss of AnkG expression may prevent the arrival of Cx43 to its final destination. PMID: 22180603
results support a specific genetic contribution of ANK3 to bipolar disorder though failed to replicate findings for schizophrenia. PMID: 21702894
The ANK3 rs9804190 C allele increases the risk for schizophrenia by affecting ANK3 expression levels PMID: 21893642
These results further support that ANK3 is a susceptibility gene specific to bipolar disorder and that more than one risk locus is involved. PMID: 21972176
association of SNPs rs10994336 and rs9804190 with bipolar disorders and psychosis subphenotype PMID: 21767209
This study demonistreated that ANK3 genotype was associated with proneness to anhedonia. PMID: 21676128
we did not find evidence for association between the bipolar disorder risk polymorphisms rs10994336 in the ANK3 gene and rs1006737 in the CACNA1C gene in migraine PMID: 21395576
results suggest that allelic variation in ANK3 impacts cognitive processes associated with signal detection and this mechanism may relate to risk for Bipolar Disorder PMID: 21304963
These findings supported the association between ANK3 and bipolar disorder, and also suggested the genomic region around rs1938526 as a common risk locus across ethnicities. PMID: 21438140
there is genetic variation local to ANK3 gene affecting its expression, but that this variation is not responsible for increasing risk of bipolar disorder. PMID: 20636642
The association of ANK3 with schizophrenia is intriguing in light of recent associations of ANK3 with bipolar disorder, thereby supporting the hypothesis of an overlap in genetic susceptibility between these psychopathological entities. PMID: 20185149

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.