Recombinant Human Antithrombin III/ATIII Protein
Beta LifeScience
SKU/CAT #: BLA-12164P
Recombinant Human Antithrombin III/ATIII Protein
Beta LifeScience
SKU/CAT #: BLA-12164P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | ANT3_HUMAN Antithrombin Antithrombin III Antithrombin-III AntithrombinIII AT 3 AT III AT3 AT3D ATIII Heparin cofactor I MGC22579 Serine (or cysteine) proteinase inhibitor clade C (antithrombin) member 1 Serine cysteine proteinase inhibitor clade C member 1 Serine proteinase inhibitor clade C member 1 Serpin C1 Serpin family C member 1 Serpin peptidase inhibitor clade C (antithrombin) member 1 SERPINC1 THPH7 |
Description | Recombinant Human Antithrombin III/ATIII Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAEPRDIPMN PMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD SKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQ IHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNDLYVSDAFHKAFL EVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFM GRVANPCVK |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |