Recombinant Human ARL3 Protein
Beta LifeScience
SKU/CAT #: BLA-12223P
Recombinant Human ARL3 Protein
Beta LifeScience
SKU/CAT #: BLA-12223P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P36405 |
Synonym | ADP ribosylation factor like 3 ADP-ribosylation factor-like protein 3 Arf like 3 Arf like protein 3 ARFL3 ARL3 ARL3_HUMAN |
Description | Recombinant Human ARL3 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMGLLSILRKLKSAPDQEVRILLLGLD NAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRP YWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFAN KQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKN VNAKKK |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |