Recombinant Human Aromatase Protein
Beta LifeScience
SKU/CAT #: BLA-12234P
Recombinant Human Aromatase Protein
Beta LifeScience
SKU/CAT #: BLA-12234P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P11511-2 |
Synonym | ARO ARO1 Aromatase CP19A_HUMAN CPV1 CYAR CYP19 Cyp19a1 CYPXIX Cytochrome P-450AROM Cytochrome P450 19A1 Cytochrome P450, family 19, subfamily A, polypeptide 1 Cytochrome P450, subfamily XIX (aromatization of androgens) Estrogen synthase Estrogen synthetase Flavoprotein linked monooxygenase MGC104309 Microsomal monooxygenase OTTHUMP00000162543 OTTHUMP00000198350 P 450AROM |
Description | Recombinant Human Aromatase Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGP GYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS SSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMK ALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSN TLFLRIPLDGTEIFTLTS |
Molecular Weight | 50 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |