Recombinant Human BTNL2 Protein (C-6xHis)
Beta LifeScience
SKU/CAT #: BLC-11445P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human BTNL2 Protein (C-6xHis)
Beta LifeScience
SKU/CAT #: BLC-11445P
Regular price
$94900
$949.00
Sale price$29900
$299.00Save $650
/
Product Overview
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9UIR0 |
Target Symbol | BTNL2 |
Species | Human |
Expression System | E.coli |
Tag | C-terminal 6xHis-tagged |
Target Protein Sequence | KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW |
Expression Range | 24-455aa |
Protein Length | Partial |
Mol. Weight | 55.0 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Function | Negative regulator of T-cell proliferation. |
Subcellular Location | Membrane; Single-pass type II membrane protein. Note=Isoform 2 is present in the nuclear, vesicle and plasma membranes, isoform 3 is found in cytoplasmic vesicle structures and is not membrane bound. |
Protein Families | Immunoglobulin superfamily, BTN/MOG family |
Database References |
HGNC: 1142 OMIM: 606000 KEGG: hsa:56244 STRING: 9606.ENSP00000419512 UniGene: Hs.534471 |
Tissue Specificity | Expressed in brain, heart, kidney, liver, pancreas, ovary, leukocyte, small intestine, testis and thymus. |