Recombinant Human C-C Motif Chemokine 1 (CCL1) Protein (His-HA)

Name: Recombinant Human C-C Motif Chemokine 1 (CCL1) Protein (His-HA)
Brand: Beta LifeScience
SKU: BLC-07588P
Price: 299.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Price Save $99

Size

100ug

Product Overview

Description	Recombinant Human C-C Motif Chemokine 1 (CCL1) Protein (His-HA) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P22362
Target Symbol	CCL1
Synonyms	(Small-inducible cytokine A1)(T lymphocyte-secreted protein I-309)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-HA
Target Protein Sequence	KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Expression Range	24-96aa
Protein Length	Full Length of Mature Protein
Mol. Weight	11.1 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
Subcellular Location	Secreted.
Protein Families	Intercrine beta (chemokine CC) family
Database References	HGNC: 10609 OMIM: 182281 KEGG: hsa:6346 STRING: 9606.ENSP00000225842 UniGene: Hs.72918

Gene Functions References

Chemokine (C-C motif) ligand 1 ( CCL1) is preferentially Plasma levels of CCL1 were significantly higher in patients with HAM/TSP. Minocycline inhibited the production of CCL1 in HTLV-1-infected T-cell lines. PMID: 29202792
downregulation of miR-20a-5p is caused by promoter hypermethylation. MiR-20a-5p could also suppress the production of IL-17 by targeting OSM and CCL1 production in CD4(+) T cells in patients with active VKH. PMID: 28972028
was to evaluate the possible association between CCL1 rs2072069 G/A or/and TLR2 rs3804099 T/C (T597C) polymorphisms and pulmonary tuberculosis (PTB) or/and tuberculous meningitis (TBM) in a sample of the Chinese adult population PMID: 26722451
The results of the present study demonstrated that GAS5 was able to suppress bladder cancer cell proliferation, at least partially, by suppressing the expression of CCL1. PMID: 26548923
CCL1-CCR8 interaction may play a critical role in lymphocytic recruitment in IgG4-related sclerosing cholangitis and type 1 autoimmune pancreatitis, leading to duct-centred inflammation and obliterative phlebitis. PMID: 23811304
CCL1 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249
These data identify a novel function for CCL1-CCR8 in metastasis and lymph node LECs as a critical checkpoint for the entry of metastases into the lymph nodes. PMID: 23878309
CCL1, CCL26, and IgE may be associated with pruritus in cutaneous T-cell lymphoma. PMID: 22948508
C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity PMID: 22479563
There was a borderline association between a single nucleotide polymorphism located within the CCL1 gene and predisposition to tuberculosis using a singlepoint analysis PMID: 22147355
ACEI is effective in downregulating LPS-induced TNF-alpha, I-309, and IP-10, which play important roles in the pathogenesis of inflammation PMID: 21849907
After stimulation via high-affinity FcepsilonRI, the transcriptional levels of I-309 (CCL1), MIP-1alpha (CCL3) and MIP-1beta (CCL4) were found among the 10 most increased human and mouse transcripts from approximately 12 000 genes PMID: 12393595
Transfected human CCL1 up-regulated ERK1/2 MAPK phosphorylation in BW5147 cells. CCL1 activates the MAPK pathway in CCR8-transfected CHO cells. PMID: 12645948
the axis CCL1-CCR8 links adaptive and innate immune functions that play a role in the initiation and amplification of atopic skin inflammation PMID: 15814739
CC chemokine ligand 1 may play a role in lymphocyte recruitment in bronchial asthma PMID: 16540498
Benzo(a)pyrene and an aryl hydrocarbon receptor agonist enhance activitity of te Ccl1 promoter. PMID: 16679317
Thus, CCL1 is a CC chemokine with a unique pattern of regulation associated with a distinct form of M2 (Type 2, M2b) monocyte activation, which participates in macrophage-dependent regulatory circuits of innate and adaptive immunity. PMID: 16735693
Variants in the CCL1 gene are associated with susceptibility to AEs through their potential implication in the host defense mechanisms against AEs. PMID: 16864713
The mechanisms underlying the mast cell-CD4-positive T lymphocyte axis is determined by mast cell-derived CCL1 and a subset of CD4-positive T cells expressing CCR8. PMID: 17641040
The combination of 17beta-E(2) with the environmental pollutant TCDD is involved in the pathogenesis of endometriosis via up-regulating the chemokine CCR8-I-309. PMID: 17693327
6 single nucleotide polymorphisms in CCL1 were found to be associated with tuberculosis in a case-control genetic association study with 273 TB cases and 188 controls PMID: 19057661
serum CCL1 levels were slightly, but statistically significantly, correlated with serum IgE levels in patients with bullous pemphigoid. PMID: 19117730
The authors show here that PRV-gG binds to the human chemokine CL1 and several CC and CXC human chemokines with high affinity. PMID: 19776237

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.