Recombinant Human C-C Motif Chemokine 3 (CCL3) Protein (His)

Name: Recombinant Human C-C Motif Chemokine 3 (CCL3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00102P
Price: 349.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Chemokines and receptors, Cytokines, Cytokines and growth factors, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant proteins holiday sale

Price Save $49

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-C Motif Chemokine 3 (CCL3) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P10147
Target Symbol	CCL3
Synonyms	(G0/G1 switch regulatory protein 19-1)(Macrophage inflammatory protein 1-alpha)(MIP-1-alpha)(PAT 464.1)(SIS-beta)(Small-inducible cytokine A3)(Tonsillar lymphocyte LD78 alpha protein)(4-69)(LD78-alpha(4-69)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	C-6His
Target Protein Sequence	SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Expression Range	24-92aa
Protein Length	Full Length of Mature Protein
Mol. Weight	14.6 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Subcellular Location	Secreted.
Protein Families	Intercrine beta (chemokine CC) family
Database References	HGNC: 10627 OMIM: 182283 KEGG: hsa:6348 STRING: 9606.ENSP00000225245 UniGene: Hs.514107

Gene Functions References

Tumor levels of CCL2 (mean +/- standard deviation = 530.1 +/- 613.9 pg/mg), CCL3 (102.7 +/- 106.0 pg/mg), and CCL4 (64.98 +/- 48.09 pg/mg) were higher than those found in healthy tissue PMID: 30419802
During early remission from methamphetamine (MA), model mice exhibited increased anxiety-like behavior and reduced expression of chemokine (C-C motif) ligand 3 (ccl3) in the hippocampus relative to saline-treated mice. Human adults actively dependent on MA and those in early remission had elevated symptoms of anxiety as well as reductions in plasma levels of CCL3, relative to adults with no history of MA abuse. PMID: 29402784
As depression became more severe the serum levels of MIP-1alpha increased. PMID: 29339257
results suggested that genetic variants at the CCL3 and CCL4 loci may be marker SNPs for risk of HCV treatment outcome. PMID: 29705123
Telomere length and mRNA expressions of IL6 and MIP1alpha were significantly longer or higher in bone marrow mesenchymal stem cells of multiple myeloma than those of controls. PMID: 28677723
The CCL3 and CCL4 chemokines might not be involved in differential susceptibility to the digestive and cardiac clinical forms of chronic Chagas disease, and it seems they do not influence the development of LVSD. PMID: 28002786
The serum levels of IL-8, MIP-1 alpha, MIP-1 beta, MMP-8, Resistin, FLRG, and BCAM were significantly higher in breast cancer patients, but LAP and TSH-beta levels were lower. PMID: 26898119
the DR3/TL1A pathway directly enhances human OC formation and resorptive activity, controlling expression and activation of CCL3 and MMP-9. PMID: 28062298
serum levels of MIP-1alpha could predict survival outcomes in patients with ENKTL. PMID: 26928433
elevated CCL3 in the leukemic environment suppresses erythropoiesis via CCR1-p38 activation PMID: 27109512
analysis of sudden infant death syndrome brains shows downregulation of MyD88 in tissue from SIDS brains, as well as the downregulation of the genes encoding CCL3 and UNC13 in the liver PMID: 26959483
we demonstrate an association of CCL3 expression by CLL cells with increased numbers of CD3+ T cells and CD57+ cells in the lymph node microenvironment, which may promote CLL cell survival and proliferation. PMID: 26458057
The N termini of CC chemokines are shown to be involved in receptor binding and oligomerization. We also report an alternative CCL3 oligomer structure that reveals how conformational changes in CCL3 N termini profoundly alter its surface properties and dimer-dimer interactions to affect GAG binding and oligomerization. Such complexity in oligomerization and GAG binding enables intricate, physiologically relevant regulatio PMID: 27091995
CCL3 promotes VEGF-A expression and angiogenesis in human osteosarcoma cells by down-regulating miR-374b expression via JNK, ERK, and p38 signaling pathways. PMID: 26713602
The residues on the N-loop and beta-sheets of MIP-1a are close to both CCR1 and CCR5, and those in the C-terminal helix region are close to CCR5. PMID: 26472202
An increased MIP-1alpha level in nasopharyngeal aspirates from patients with acute respiratory symptoms during the first wheezing episode caused by viral infections might predict recurrent wheezing. PMID: 26494023
Tregs from subjects with established type 1 diabetes were impaired in their ability to produce CCL3 and CCL4. PMID: 26854929
Pleural and serum MIP1a were lower in patients with lung cancer compared to lung metastasis, pneumonia, tuberculosis, and transudate pleural effusion. PMID: 26620310
AEG-1 mediates CCL3/CCR5-induced EMT development via both Erk1/2 and Akt signaling pathway in CM patients, which indicates CCL3/CCR5-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of CM. PMID: 26134542
The EP in TKA differed from EP in aseptically failed THA by lower CCL3 and DC-STAMP mRNA and protein expression. EP of all studied inflammatory and osteoclastogenic molecules were similar in knee and hip OA. PMID: 25151085
A significantly higher percentage of healthy asymptomatic persons possibly exposed to asbestos had detectable levels of serum CCL3 compared to healthy unexposed control subjects. PMID: 25940505
APOE varepsilon4 genotype specifically modulates astrocyte secretion of potent microglial chemotactic agents, including CCL3 PMID: 25092803
Macrophage inflammatory protein-1alpha shows predictive value as a risk marker for subjects and sites vulnerable to bone loss in a longitudinal model of aggressive periodontitis. PMID: 24901458
In COPD patients, CCL3 is upregulated in sputum and may facilitate recruitment of macrophages into airways. PMID: 25183374
Serum/urinary MIP-1a responds to infection but cannot be used as reliable biomarker in childhood urinary tract infections. PMID: 25618120
Sequence variants in the CCL3 chemokine gene family in the HapMap West African reference population have been identified. PMID: 24952210
MIP-1alpha levels in Jurkat cells appeared to be an important factor for its transendothelial migration PMID: 25245399
se results indicate that CCL2 and CCL3 are associated with progression of oral squamous cell carcinoma PMID: 25060177
Our results confirm the strong influence of previous immunity in subsequent dengue infections, and confer a possible pathogenic role to CCR1 and CCL3 in dengue disease and a possible protective role for CCL5, probably through CCR5 interaction. PMID: 24157267
The detection of basal level of IgM rheumatoid factor, IgM and also certain cytokines can be useful in prognosis of effectiveness of rituximab therapy under rheumatoid arthritis. PMID: 25080789
Gene expression profiling in bone marrow from multiple myeloma patients with and without osteolysis vs controls with other hematologic neoplasms showed only weak CCL3 expression. PMID: 24556596
MIP-1alpha is a predominant factor responsible for the enhancement of bone resorption and increased angiogenesis PMID: 24277416
Greater adiposity is associated with higher MIP-1alpha and lower soluble CD14 levels, possibly reflecting an important role for cells of the monocyte/macrophage lineage. PMID: 23748193
Transcription of CCL3 and CCL4 by THP-1 monocytic cells up-regulated in the presence of 27-Hydroxycholesterol and 7alpha-hydroxycholesterol. PMID: 24370436
the role of Tax2-mediated activation of the nuclear factor kappa B (NF-kappaB) signalling pathway on the production of the anti-viral CC-chemokines MIP-1alpha, MIP-1beta and RANTES. PMID: 24116893
Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1. PMID: 23818986
JAK2 and STAT3 activation is not essential for CCL3, CCL5 or CCL8 induced chemotaxis. PMID: 22987449
Epstein-Barr virus latent membrane protein 1 (LMP1)-mediated Jun N-terminal protein kinase activation was responsible for upregulation of CCL3 and CCL4 in B cells. PMID: 23760235
either the CCL3 gene may play a significant role in CCL3 production and/or that as yet undefined mechanisms regulate production of CCL3 from variable CCL3L copy number. PMID: 23295355
High serum CCL-3 is associated with disease severity of generalized pustular psoriasis. PMID: 23334651
These findings suggest that MIP-1alpha and IL-17 may play important roles in acute exacerbation of asthma induced by RSV in an animal model. PMID: 23711864
This study examined the role of three African CCL3 haplotypes in HIV-1 infant susceptibility, maternal HIV-1 transmissibility and HIV-1 disease progression in the mothers. PMID: 23151487
These findings suggest that the increased expression of CCL3, CCR1, and CCR5 may influence the immune response in RAS by T(H)1 cytokine polarization. PMID: 22727097
Our findings indicate that TNFalpha and IL-1beta modulate the expression of CCL3 in nucleus pulposis cells by controlling the activation of MAPK, NF-kappaB, and C/EBPbeta signaling. PMID: 23233369
Our results suggest vital roles for CCL3-mTORC2-isoform PKB/Akt1 S473 phosphorylation axis in FOXP3+Treg cells and the development of psoriasis. PMID: 23223135
Serum CCL3, CCL5 and CCL18 are independently associated with the risk of short-term mortality in acute coronary syndrome patients. PMID: 23029252
Tumor-infiltrating monocytic myeloid-derived suppressor cells produce high levels of transgenic CCR5 ligands CCL3, CCL4, and CCL5 and directly attract regulatory T cells (Tregs) in a CCR5-dependent manner. PMID: 23152559
MIP-1alpha was found to correlate with WHO grade among invasive gliomas, and MIP-1alpha promoted human glioblastoma cell proliferation and migration. PMID: 22307528
The mRNA expression of MIP-1alpha was markedly higher in chronic nonbacterial prostatitis/chronic pelvic pain syndrome patients than in controls. PMID: 22295852
Data indicate that IFN2b treatment upregulates the expression of CCR5, RANTES, MIP-1alpha and MIP-1beta on monocytes/macrophages. PMID: 22085486

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.