Recombinant Human CCR8 Protein
Beta LifeScience
SKU/CAT #: BLA-12662P
Recombinant Human CCR8 Protein
Beta LifeScience
SKU/CAT #: BLA-12662P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | C C chemokine receptor type 8 C C CKR 8 C C motif chemokine receptor 8 C-C chemokine receptor type 8 C-C CKR-8 CC chemokine receptor 8 CC chemokine receptor CHEMR1 CC chemokine receptor type 8 CC CKR 8 CC-CKR-8 CCR 8 CCR-8 Ccr8 CCR8 protein CCR8-L CCR8_HUMAN CDw198 CDw198 antigen Chemokine (C C motif) receptor 8 Chemokine (C C) receptor 8 Chemokine (C C) receptor like 2 Chemokine (CC motif) receptor 8 Chemokine (CC) receptor 8 Chemokine (CC) receptor like 1 Chemokine (CC) receptor like 2 Chemokine C C motif receptor 8 Chemokine C C receptor 8 Chemokine CC motif receptor 8 Chemokine CC receptor 8 Chemokine receptor 8 Chemokine receptor like 1 Chemokine receptor-like 1 CKR L1 CKR-L1 CKRL 1 CKRL1 CMKBR 8 CMKBR L2 CMKBR8 CMKBRL 2 CMKBRL2 CY 6 CY6 GPR CY6 GPR-CY6 GPRCY6 MGC123958 MGC123959 MGC129966 MGC129973 TER 1 TER1 |
Description | Recombinant Human CCR8 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSL LGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWV FGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMG TTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNF KMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLF WVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSS VDYIL |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |