Recombinant Human Clusterin (CLU) Protein (His)

Name: Recombinant Human Clusterin (CLU) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00978P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant proteins holiday sale

Price Save $760

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Clusterin (CLU) Protein (His) is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P10909
Target Symbol	CLU
Synonyms	(Aging-associated gene 4 protein)(Apolipoprotein J)(Apo-J)(Complement cytolysis inhibitor)(CLI)(Complement-associated protein SP-40,40)(Ku70-binding protein 1)(NA1/NA2)(Sulfated glycoprotein 2)(SGP-2)(Testosterone-repressed prostate message 2)(TRPM-2)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Target Protein Sequence	DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Expression Range	23-449aa
Protein Length	Full Length of Mature Protein
Mol. Weight	52.3 kDa
Research Area	Apoptosis
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Functions as extracellular chaperone that prevents aggregation of non native proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Protects cells against apoptosis and against cytolysis by complement. Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. A mitochondrial form suppresses BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation. An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5. Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3. Plays a role in the clearance of immune complexes that arise during cell injury.; Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity.; Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. Promotes cell death through interaction with BCL2L1 that releases and activates BAX.
Subcellular Location	[Isoform 1]: Secreted.; [Isoform 4]: Cytoplasm.; [Isoform 6]: Cytoplasm.; Nucleus. Cytoplasm. Mitochondrion membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol. Microsome. Endoplasmic reticulum. Mitochondrion. Mitochondrion membrane. Cytoplasm, perinuclear region. Cytoplasmic vesicle, secretory vesicle, chromaffin granule.
Protein Families	Clusterin family
Database References	HGNC: 2095 OMIM: 185430 KEGG: hsa:1191 STRING: 9606.ENSP00000315130 UniGene: Hs.436657
Tissue Specificity	Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. Detected in brain,

Gene Functions References

The plasma levels of septin-9 and clusterin in ovarian cancer patients were abnormally elevated, which might be used as potential candidates of peripheral blood tumor biomarkers for early diagnosis of EOC and septin-9 might be related to distal metastases of EOC. PMID: 29970704
Data suggest that the potential of clusterin and glutathione synthetase (GSH-S) as platelet biomarkers for early detection of colorectal cancer (CRC) could improve existing screening modalities in clinical application. PMID: 28849249
recombinant alpha- and beta-chains exhibit structural and functional differences and differ in their sub-cellular localization. PMID: 28120874
miR-195 improved the sensitivity of resistant prostate cancer cells to docetaxel by suppressing CLU. PMID: 29665645
The VDR/MEG3/Clusterin signaling pathway may serve as potential therapeutic targets and prognosis biomarkers for colorectal cancer patients in future. PMID: 29628342
Meta analysis validated the Alzheimer disease protective association for CLU (rs11136000) variants. PMID: 29504051
that the Clusterin rs11136000 polymorphism C allele is associated with AD susceptibility PMID: 29396813
clusterin promotes growth and invasion in renal cell carcinoma cells in vitro and in vivo through upregulation of S100A4 PMID: 29400663
The results showed that secreted CLU was overexpressed in three hepatocellular carcinoma cell lines. The downregulation of CLU by CLU shRNA synergistically increased Sorafenib sensitivity in the Bel7402 and SMMC7721 cells, and potentiated Sorafenib induced cell apoptosis. PMID: 29436591
Our study showed low clusterin immunostaining in colorectal carcinoma with lack of association with prognostic indicators PMID: 29279586
This study showed that the 1- and 2-year follow-up, generalized estimating equation analyses of Alzheimer's disease patients revealed that high levels of plasma clusterin at baseline were associated with a significantly larger decrease in Mini-Mental State Examination compared with low levels of plasma clusterin. PMID: 29169407
plasma level decreases in healthy but not in asthmatic pregnancy and correlates directly with lung function PMID: 29200898
Downregulation of apoE and apoJ in CSF strongly suggests a critical role of lipid metabolism in the development and progression of Moyamoya disease. PMID: 28843803
Our study may help to further elucidate the development and progression of non-small cell lung cancer , also it may contribute to the research of therapies targeting sCLU. PMID: 28954633
Using global proteomic profiling of brain leptomeningeal arteries, this study revealed that clusterin and tissue inhibitor of metalloproteinases-3 increase in leptomeningeal arteries affected by cerebral amyloid angiopathy. PMID: 27543695
The presence of microbial invasion of the amniotic cavity, intra-amniotic inflammation (IAI), and microbial-associated IAI was characterized by lower amniotic fluid clusterin concentrations in pregnancies complicated by preterm prelabor rupture of membranes. PMID: 27806672
Our meta-analysis demonstrated that the rs9331888/C> G polymorphism in the clusterin gene might contribute to Alzheimer disease susceptibility especially in Caucasian populations. PMID: 28168383
these findings revealed that CLU genotypes could probably modulate the cerebral the Abeta loads on imaging and volume of hippocampus PMID: 27229352
No association for CLU with Alzheimer's disease in south-Indian population. PMID: 28558900
we confirm that a PEX/Alzheimer's Disease associated risk variant, rs2279590, resides within an enhancer element and regulates the expression of three candidate genes CLU, PTK2B and EPHX2, which were previously known to be modulators in the progression of Alzheimer's Disease. PMID: 28973302
Silencing the expression of CLU could improve the anticancer efficacy of CPT. PMID: 28064403
Thus, we suggest that a combination of PI3K/AKT/mTOR inhibitors with V-ATPase inhibitors might be an effective approach for NSCLC treatment. PMID: 29253572
plasma clusterin was associated with lower volume of the entorhinal cortex, an area that atrophies early in AD. Clusterin could be informative as part of a multi-component preclinical marker for AD PMID: 29324756
This study demonstrated that Apo J expression preferentially occurs in neurons in brain in patient with Alzheimer's Disease. PMID: 27197790
Hippocampal shape features derived from the diffeomorphic metric-based shape analysis led to the identification of significant CLU-PICALM interaction effects on hippocampal morphology in young healthy adults, which were not identified by volume measurement and voxel-wise analysis. PMID: 27017968
CLU-C allele contrubutes to architectural disruptions in resting-state networks in amnestic mild cognitive impairment (aMCI) subjects (i.e., individuals with elevated risk of AD). PMID: 26899953
A total of 249 epileptic patients and 289 healthy controls were included in this study. Three Clusterin single nucleotide polymorphisms (SNPs: rs11136000, rs9314349, and rs9331949) were selected and genotyped with the SNaPshot assay. Our study failed to detect an association between Clusterin polymorphisms (rs11136000, rs9314349, and rs9331949) and epilepsy in a Han Chinese population. PMID: 28972394
Subarachnoid hemorrhage is associated with immediate decrease in CSF clusterin concentrations. PMID: 28803177
Serum ApoJ levels are closely correlated with the magnitude of insulin resistance. PMID: 28986164
data confirm that the association of psoriatic disease with some comorbidities, especially metabolic and cardiovascular disease, might support the correlation with increased circulating Clu. PMID: 28958138
blood platelets have a role in amyloid-beta aggregation in cerebral vessels through integrin alphaIIbbeta3-induced outside-in signaling and clusterin release PMID: 27221710
The results identify Clusterin as a new molecular partner involved in apoptotic cell efferocytosis and suggest a protective role for Clusterin in inflammation and autoimmune diseases. PMID: 27148688
CLU as novel and promising biomarker for prognosis in patients with chronic HF PMID: 28391884
FRET and co-IP assays demonstrated that Clu interacted with beta-amyloid peptide, a pathological protein of AD, which suggested a potential effect of SelR and Abeta with the aid of Clu. The interaction between SelR and Clu provides a novel avenue for further study on the mechanism of SelR in AD prevention. PMID: 23805218
The findings of this study provided further evidence for the CLU risk variant as a candidate gene for Alzheimer disease and may serve as a pre-clinical neuroimaging phenotype of late-onset Alzheimer disease. PMID: 27396407
Study demonstrate high concentrations of clusterin (CLU) in mucus samples and significantly reduced CLU levels in cases with endometriosis receiving contraception compared to cases with endometriosis without contraception. PMID: 27071964
Risk-reducing clusterin genotypes protect against the consequences of poor vascular health on executive function performance and change in older adults without dementia. PMID: 27143425
Addition of the minor allele for rs670139 (MS4A4E), rs9331896 (CLU), and rs12155159 (NME8) was nominally associated with change on the DWRT, DSST, and WFT, respectively, in whites. For rs670139 and rs9331896 the association was only significant in individuals bearing at least one APOE 4 allele in stratified analyses. PMID: 27781389
CLU expression is related to the cellular type and inversely correlated with the presence of lymph node metastases in medullary thyroid carcinoma. PMID: 28411179
Melittin is capable of suppressing tumor growth and promoting gemcitabine sensitivity in pancreatic ductal adenocarcinomas by downregulating cholesterol pathway gene CLU. PMID: 28428074
Data show that ELOVL7, SOCS3, ACSL4 and CLU were upregulated while PRKAR1A and ABCG1 were downregulated in the phlegm-dampness group. PMID: 27928700
Both CLU and PLXNA4 have been genetically associated with Alzheimer disease (AD) risk and our data thus provide a direct relationship between two AD risk genes. Our data suggest that increasing the levels of PLXNA4 or targeting CLU-PLXNA4 interactions may have therapeutic value in AD. PMID: 27378688
Although further studies are required to determine how clusterin suppresses non-specific cellular uptake in phagocytes, our data suggest that clusterin plays a key role in the stealth effect of not only pegylated nanoparticles but also non-pegylated nanoparticles. PMID: 27983983
the initial rapid aggregation of LDL(-) is apparently counterbalanced by the stabilizing effects of minor proteins such as apoA-I and apoJ. These results help identify key determinants for LDL aggregation, fusion and coalescence into lipid droplets in vivo. PMID: 27233433
The rs9331888 "GG" genotype in patients and the "CC" genotype in controls were significantly higher in non-4 allele carriers of APOE The haplotype analysis showed the CLU "GCG" haplotype was a risk haplotype. PMID: 27076484
Study explored the common effects of the clusterin (CLU) rs11136000 variant on the default mode network (DMN) in amnestic mild cognitive impairment (aMCI) subjects and remitted geriatric depression (RGD) subjects. The CLU rs11136000 variant could consistently affect the changing of DMN patterns of aMCI and RGD subjects in the frontal cortex. PMID: 28233427
Findings indicate that in Alzheimer's disease, clusterin increases, particularly in regions with most abundant Abeta, but because the increase does not match the rising level of Abeta42, the molar ratio of clusterin : Abeta42 in those regions falls, probably contributing to Abeta deposition within the tissue PMID: 27248362
possible local regulatory role for clusterin in the adipose tissue rather than its systemic involvement in the regulation of energy homeostasis PMID: 27070750
Study identified significant association of the CLU rs9331888 polymorphism with Alzheimer's disease susceptibility in Caucasian population but not in East Asian population (Meta-analysis). PMID: 25633098
Our results suggest clusterin plays a role in modulating the inflammatory response of acute and chronic traumatic brain injury and that it is a useful marker for TBI, particularly in cases with short survival times. Its prominent accumulation in astrocytes, alongside a mounting inflammatory response and activation of microglial cells supports a potential role in the neurodegenerative changes that occur as a result of TBI. PMID: 27365216

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.