Recombinant Human Complement C1Q Tumor Necrosis Factor-Related Protein 3 (C1QTNF3) Protein (His&Myc)

Name: Recombinant Human Complement C1Q Tumor Necrosis Factor-Related Protein 3 (C1QTNF3) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-05229P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant proteins holiday sale

Price Save $1,055

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Complement C1Q Tumor Necrosis Factor-Related Protein 3 (C1QTNF3) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9BXJ4
Target Symbol	C1QTNF3
Synonyms	C1ATNF3; C1q and tumor necrosis factor related protein 3 ; C1QT3_HUMAN; C1qtnf3; Cartonectin; Collagenous repeat containing sequence of 26 kDa; collagenous repeat-containing sequence 26 kDa protein; Complement C1q tumor necrosis factor related protein 3 ; Complement C1q tumor necrosis factor-related protein 3; Corcs; CORS 26; Cors; CORS26; CTRP3; FLJ37576; OTTHUMP00000115918; OTTHUMP00000219981; PRO1484; Secretory protein CORS26; UNQ753
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-10His&C-Myc
Target Protein Sequence	QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Expression Range	28.1 kDa
Protein Length	Full Length of Mature Protein
Mol. Weight	28.1 kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Secreted.
Database References	HGNC: 14326 OMIM: 612045 KEGG: hsa:114899 STRING: 9606.ENSP00000371497 UniGene: Hs.171929
Tissue Specificity	Expressed in colon and small intestine.

Gene Functions References

we have developed a diagnostic and prognostic prediction model for Prostate cancer. C1QTNF3 was revealed as a promising biomarker for Prostate cancer PMID: 29861410
CTRP3 may be a promising therapeutic target for the treatment of liver fibrosis. PMID: 28320106
Elevated serum CTRP 3 levels were closely related to the prevalence and severity of coronary artery disease, suggesting that it might be regarded as a novel biomarker for CAD. PMID: 28754090
defensive roles in suppressing inflammation and fibrosis in polymeric IgA complex-stimulated mesangial cells; may target the NF-kappaB and TGF-beta/Src-Smad3 signaling pathways to play multipotent roles in relieving the pathological progression of IgA nephropathy PMID: 27309491
CTRP3 promotes mitochondrial biogenesis in cardiomyocytes via AMPK/PGC-1alpha pathway. PMID: 27793739
Low CTRP3 expression is associated with diabetic retinopathy. PMID: 28632765
decreased levels of CTRP3 and especially CTRP13 were associated with increased risk of T2DM and CAD PMID: 28033351
both plasma CTRP-3 and HMGB-1 levels were significantly associated with pre-diabetes mellitus and newly diagnosed type 2 diabetes after adjusting for several confounders PMID: 27738641
This research suggested that CTRP3 might protect chondrocytes against IL-1beta-induced osteoarthritis in a cell model by suppressing the FGFR1- Ras/PI3K/Akt signaling-mediated growth inhibitory pathway. PMID: 27930985
CTRP3 could improve insulin sensitivity of insulin resistant 3T3-L1 adipocytes by decreasing inflammation and ameliorating insulin signalling transduction, indicating that CTRP3 may be a new target for the prevention and cure of insulin resistance and type 2 diabetes. PMID: 25185846
CTRP3 is present in cord blood and might be involved in fetal growth PMID: 26656444
CTRP3 overexpression altered chemokine levels and attenuated systemic inflammation in the setting of obesity. PMID: 26997632
Lower Circulating C1q/TNF-Related Protein-3 (CTRP3) Levels Are Associated with Obesity PMID: 26222183
plasma CTRP-3 is strongly associated with glucose and lipid metabolism, chronic inflammation, and insulin resistance. PMID: 26073386
Results show that cartonectin may serve as a novel biomarker for the prediction and early diagnosis of type 2 diabetes mellitus patients. PMID: 25409499
Patients with acute coronary syndrome or stable angina pectoris had significantly lower circulating CTRP-3 concentrations compared to controls. PMID: 24417980
CTRP3 promotes vascular calcification by enhancing phosphate-induced osteogenic transition of VSMC through reactive oxygen species-extracellular signal-regulated kinase 1/2-Runx2 pathway. PMID: 24578384
Data suggest that serum/omental adipose tissue (AT) cartonectin levels are lower in women with polycystic ovary syndrome; treatment with a hypoglycemic agent (metformin) increases serum cartonectin levels in these women and in omental AT explants. PMID: 24152681
Data suggest that CTRP3 is expressed in subcutaneous and visceral adipocytes; CTRP3 appears to play important roles in adipocyte (epinephrine-induced) lipolysis, inflammation/infection, and adipokine/resistin secretion. PMID: 23174996
Data suggest that patients exhibit significantly elevated circulating CTRP-3 in type 2 diabetes or prediabetes compared with subjects with normal glucose tolerance. Plasma CTRP-3 might be useful biomarker for atherosclerosis. PMID: 22837306
This study provides the first functional evidence linking CTRP3 to hepatic glucose metabolism and establishes CTRP3 as a novel adipokine. PMID: 20952387
CTRP-3 inhibits three basic and common proinflammatory pathways involved in obesity and type 2 diabetes mellitus (adipo-inflammation) by acting as an endogenous LPS antagonist of the adipose tissue. PMID: 20739398
Genotyping of the shared variants in a Puerto Rican sample of 118 cases and 136 controls did not reveal either allelic or genotype association with schizophrenia. PMID: 20483475
Blood level is determined by a glucose tolerance test in normal adults PMID: 17311679
CTRP3/cartducin may be involved as a novel angiogenic factor in the formation of neointima following angioplasty. PMID: 17534697
CORS26/cartonectin is a new adipokine that differentially regulates the secretion of classical adipokines, with marked differences between the human and the murine systems. PMID: 18421280

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.