Recombinant Human Cytokine-Like Protein 1 (CYTL1) Protein (hFc)

Name: Recombinant Human Cytokine-Like Protein 1 (CYTL1) Protein (hFc)
Brand: Beta LifeScience
SKU: BLC-01295P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant proteins holiday sale

Price Save $1,220

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cytokine-Like Protein 1 (CYTL1) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9NRR1
Target Symbol	CYTL1
Synonyms	Protein C17
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFC
Target Protein Sequence	TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR
Expression Range	23-136aa
Protein Length	Full Length of Mature Protein
Mol. Weight	40.8 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Secreted.
Database References	HGNC: 24435 OMIM: 607930 KEGG: hsa:54360 STRING: 9606.ENSP00000303550 UniGene: Hs.13872
Tissue Specificity	Specifically expressed in CD34+ hematopoietic cells.

Gene Functions References

Circular dichroism analysis showed that, like chemokines, CYTL1has a higher content of beta-sheet than alpha-helix secondary structure; recombinant CYTL1 promoted calcium flux in chondrocytes; unlike chemokines, CYTL1 had limited affinity to proteoglycans; together, these properties further support cytokine-like properties for CYTL1 with some overlap with the chemokines PMID: 28478073
this study shows that CYTL1 possesses chemotactic activity and demonstrates that its functional receptor is CCR2B PMID: 27084102
when the native signal peptide of CYTL1 was replaced by IgGkappaSP, the expression and secretion was increased by 4 fold. PMID: 26922322
role in regulation embryo implantation PMID: 26800213
Cytl1 is highly expressed in the endometrium during the embryo implantation and its expression is regulated by ovarian hormones. Cytl1 enhances endometrial proliferation, induces the secretion of endometrial LIF and HB-EGF, and even enhances endometrial cell adhesion to trophoblastic cells. These indicate that Cytl1 is a potential molecular mediator of embryo is a potential molecular mediator in embryo implantation. PMID: 26800213
our results showed the first evidence of CYTL1 expression in SH-SY5Y neuroblastoma cells and human NB tissues, revealed a possible link between CYTL1 and NB development PMID: 22797702
evidence suggests that ANKRD7 and CYTL1 genes may play an important role in the variance in alcohol drinking risk PMID: 22613542
C17orf62-L could induce cell death accompanied with rising of cleaved PARP. PMID: 21503106
The DNA methylation pattern of the CYTL1 promoter region was significantly different between early and advanced stages of squamous cell carcinoma. PMID: 22011669
C17 as a cytokine that s contributes to immune homeostasis systemically or in a tissue-specific manner in the joint PMID: 21799806
We report a structural-functional characterization of cytokine-like protein 1 (Cytl1) by a combination of different computational structure-based techniques. PMID: 21322034

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.