Recombinant Human Cytokine Receptor Common Subunit Gamma (IL2RG) Protein (His)

Name: Recombinant Human Cytokine Receptor Common Subunit Gamma (IL2RG) Protein (His)
Brand: Beta LifeScience
SKU: BLC-01163P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Cluster of differentiation (cd) proteins, Cytokines, Cytokines and growth factors, Featured cd protein molecules, Interleukins and receptors, Recombinant proteins, Recombinant proteins holiday sale

Price Save $907

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cytokine Receptor Common Subunit Gamma (IL2RG) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P31785
Target Symbol	IL2RG
Synonyms	IL2RG; Cytokine receptor common subunit gamma; Interleukin-2 receptor subunit gamma; IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG; gammaC; p64; CD antigen CD132
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	C-6His
Target Protein Sequence	PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Expression Range	56-254aa(N75Q)
Protein Length	Partial
Mol. Weight	25.0 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Cell surface.
Protein Families	Type I cytokine receptor family, Type 5 subfamily
Database References	HGNC: 6010 OMIM: 300400 KEGG: hsa:3561 STRING: 9606.ENSP00000363318 UniGene: Hs.84
Associated Diseases	Severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell-negative (XSCID); X-linked combined immunodeficiency (XCID)

Gene Functions References

This study identifies one novel mutation in the IL2RG gene and another, previously described mutation in the CYBB genes. It is the first report establishing a diagnosis of X-SCID and X-CGD using WES in Chinese patients. PMID: 29388853
New insights of common gamma chain in hematological malignancies. PMID: 26748725
this study shows that downregulation of miR-3940-5p promotes T-cell activity by targeting the cytokine receptor IL-2R gamma on human cutaneous T-cell lines PMID: 27502164
systematic scoping review highlights the many potential uses of soluble interleukin-2 receptor measurement in the diagnosis and treatment of hemophagocytic syndromes. PMID: 28497365
A deletion mutation in IL2RG gene results in X-linked severe combined immunodeficiency with an atypical phenotype PMID: 27566612
novel missense mutation in Japanese patient results in atypical X-linked severe combined immunodeficiency with the presence of T cells and NK cells and revertant somatic mosaicism PMID: 26407811
reversion of mutation in common lymphoid progenitor results in mild phenotype of SCID PMID: 26076747
High IL2RG expression is associated with Sezary syndrome. PMID: 26551670
Identification of a gammaC splice isoform revealed expression of soluble gammaC proteins (sgammaC). sgammaC directly interacted with surface IL-2Rbeta to suppress IL-2 signaling and to promote pro-inflammatory Th17 cell differentiation. [review] PMID: 26468051
Study show the detection of IL2RG mutations in 2 families with X-SCID and identified 2 novel mutations, confirming the X-SCID pedigrees. PMID: 26125817
Interleukin 2 receptor subunit gamma mutation is associated with X-linked severe combined immunodeficiency. PMID: 26409833
Targeting the binding interface on a shared receptor subunit of a cytokine family enables the inhibition of multiple member cytokines with selectable target spectrum. PMID: 26183780
Results demonstrate that IL2Rgamma has an onogenic role in JAK3-mutation-positive leukemias. PMID: 25109334
findings suggest that over-expression of the IL2RG gene may be implicated in altered immune response in schizophrenia and contribute to the pathomechanisms of this disorder PMID: 24713359
this is the first report on a de novo mutation in the IL2RG gene in a patient born after IVF PMID: 23790094
In a patient with a novel IL2RG mutation, gene-reverted CD8+ T cells accumulate over time. PMID: 23403317
in humans, signaling through the gammac pathway is not required for prethymic lymphoid commitment or for DNA rearrangement. PMID: 24771849
we presented here a novel IL-2Rgammac mutation in a carrier and SCID patient presenting NK cells in the peripheral blood PMID: 23940110
Massively parallel sequencing reveals maternal somatic IL2RG mosaicism in an X-linked severe combined immunodeficiency family. PMID: 23683512
Tax-specific cytotoxic T-lymphocyte cell treatment significantly decreases human soluble IL-2Rgamma serum concentrations and prolongation of survival time in a mouse model of adult T cell leukemia/lymphoma. PMID: 23733874
analysis of multiorgan metastasis of human HER-2+ breast cancer in Rag2-/-;Il2rg-/- mice and treatment with PI3K inhibitor PMID: 22737248
These data highlight the central role of IL-15 and gammac-receptor signaling in renal homeostasis. PMID: 22363690
the amount of the gamma-chain transducing element is able to influence the transcription of genes involved in cell cycle progression, thus being directly involved in the regulatory control of cell proliferation of malignant hematopoietic cell PMID: 22223761
Data imply that IL-21-mediated signaling is critical for long-lived humoral immunity and to restore antibody responses in IL2RG/JAK3-deficient patients after hematopoietic cell transplantation. PMID: 22039266
We report a novel X-CID family with a unique mutation in the extracellular part of CD132 with almost normal T-cell counts but defective memory induction PMID: 21831415
IL-2R common gamma-chain is epigenetically silenced by nucleophosphin-anaplastic lymphoma kinase (NPM-ALK) and acts as a tumor suppressor by targeting NPM-ALK. PMID: 21715655
IL-2Rgamma(c) reconstituted T cells may persist more efficiently than natural killer (NK) cells due to compensation for suboptimal IL-2Rgamma(c) signaling by T cell receptors. PMID: 20592278
Tumor-shed PGE(2) impairs IL2Rgammac-signaling to inhibit CD4 T cell survival and is regulated by theaflavins PMID: 19812686
Plasma sIL-7Ralpha and sgamma(c) are present as heterocomplexes and sgamma(c) was found to be mainly associated with sIL-7Ralpha PMID: 19494261
presence of membrane-associated as well as soluble gamma c in cell lysates and cell free supernatants from peripheral blood lymphocyte cultures; panel of human serum samples was examined and compared with sIL-2R PMID: 12036606
In normal lung fibroblasts IL-4 & IL-13 induce gamma c chain & its association with JAK3. In myofibroblasts, constitutive gamma c chain together with JAK3 controls TYK2 phosphorylation & the balance between functional & decoy high-affinity receptors. PMID: 12207328
Human IL-21 and IL-4 bind to partially overlapping epitopes of common gamma-chain. PMID: 12504082
The development of breast tumour is associated with an increased expression of IL-2 receptor gamma and this expression also seems to be associated with the malignancy of the tumour. PMID: 14680494
A mutation in this locus resulting in severe combined immunodeficiency, initially diagnosed as HIV infection. PMID: 15702055
The common cytokine receptor gamma-chain is a required signaling subunit of the growth hormone receptor (GHR) complex in B cell lines. Genetic alteration of the IL2RG gene results in growth failure in X-linked severe combined immunodeficiency (X-SCID). PMID: 17082603
results confirm that signal transduction via the IL-15R, and hence NK ontogeny, is preferentially retained relative to the IL-7R as gammac expression becomes limiting. PMID: 17363735
Review describes current state of knowledge of how the gamma c cytokine network is affected during HIV infection, with a focus on how this impairs CD4+ and CD8+ T cell function while also benefiting the virus itself. PMID: 18417356
Report the selective expansion of genetically modified T cells using an antibody/IL2RG receptor chimera. PMID: 18589435
This suggests a role for gamma(C) cytokines in the pathogenesis of diseases in which CD127 expression is altered on CD8+ T cells such as in progressive viral infections and cancer. PMID: 19011158
Self-sufficient growth of B lymphoblastoid cells in X-linked combined immunodeficiency disease (SCID) cell lines is strongly dependent on common gamma-chain expression. PMID: 19234229
the loss of NEDD4 association on IL-2Rgamma(c) is accompanied by a dramatic increase of the half-life of the receptor subunit. PMID: 19615332
Transgenic Jak3-dependent common gamma c cytokine signals are not required for naive primary CD4-positive T cell proliferation and cell cycle regulation in vitro. PMID: 19734221
Meta-analysis and HuGE review of genotype prevalence, gene-disease association, genetic testing, and healthcare-related. (HuGE Navigator) PMID: 14726805
The immature form of the gamma(c) chain is a 54-58 kDa intracellular component localized in the endoplasmic reticulum of resting, unstimulated CD4 T cells. PMID: 11418669

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.