Recombinant Human Cytokine Receptor-Like Factor 1 (CRLF1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01411P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Cytokine Receptor-Like Factor 1 (CRLF1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01411P
Regular price
$1,47800
$1,478.00
Sale price$29900
$299.00Save $1,179
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Cytokine Receptor-Like Factor 1 (CRLF1) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O75462 |
Target Symbol | CRLF1 |
Synonyms | Cytokine-like factor 1 Short name: CLF-1 ZcytoR5 |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | AHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR |
Expression Range | 38-422aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 46.5 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | In complex with CLCF1, forms a heterodimeric neurotropic cytokine that plays a crucial role during neuronal development (Probable). May also play a regulatory role in the immune system. |
Subcellular Location | Secreted. |
Protein Families | Type I cytokine receptor family, Type 3 subfamily |
Database References | |
Associated Diseases | Cold-induced sweating syndrome 1 (CISS1) |
Tissue Specificity | Highest levels of expression observed in spleen, thymus, lymph node, appendix, bone marrow, stomach, placenta, heart, thyroid and ovary. Strongly expressed also in fetal lung. |
Gene Functions References
- From these results we conclude that one should consider a CRLF1-related disorder in early onset achalasia even if other Crisponi or cold-induced sweating syndrome type 1 (CS/CISS1) related symptoms are missing. PMID: 27976805
- we show in this series of 12 patients from four families, all previously unpublished, that the homogeneity of the recently described c.983dupG (p.Ser328Argfs *2) mutation in CRLF1 was associated with a highly variable degree of severity, and that the phenotype significantly overlaps with the recently described COG6-related anhidrosis syndrome (MIM#615328 PMID: 26804344
- CLF-1, based on its binding site for CLC and on two additional and independent sites for CNTFRalpha and sorLA, is a key player in CLC and CNTFRalpha signaling and turnover. PMID: 26858303
- Article reports 11 novel mutations in CRLF1 expanding the mutational spectrum of CRLF1 in the Crisponi/cold-induced sweating type 1 syndrome to a total of 35 variants. PMID: 24488861
- The mutation detected in CRLF1 has not been described in patients with CISS1, but in one with CS. These data seem to support the theory that CS and CISS1 are variants of the same disorder. PMID: 24008591
- Data indicate that CRLF1 serves its protective role by a cell autonomous mechanism that is independent of the gp130/JAK signaling pathway. PMID: 23818941
- In idiopathic pulmonary fibrosis, CLF-1 is a selective stimulus of type II alveolar epithelial cells and may potentially drive an antifibrotic response by augmenting both T-helper-1-driven and T-regulatory-cell-driven inflammatory responses in the lung. PMID: 22429962
- CRLF1 mutations showed that phenotypic severity of the two disorders: Crisponi syndrome (CS) and cold-induced sweating syndrome type 1 (CISS1) mainly depends on altered kinetics of secretion of the mutated CRLF1 protein. PMID: 21326283
- Our data suggest that the CRLF1/CLC complex disrupts cartilage homeostasis and promotes the progress of OA by enhancing the proliferation of chondrocytes and suppressing the production of cartilage matrix PMID: 19921088