Recombinant Human Egf-Like Repeat And Discoidin I-Like Domain-Containing Protein 3 (EDIL3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00991P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Egf-Like Repeat And Discoidin I-Like Domain-Containing Protein 3 (EDIL3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00991P
Regular price
$1,06400
$1,064.00
Sale price$29900
$299.00Save $765
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Egf-Like Repeat And Discoidin I-Like Domain-Containing Protein 3 (EDIL3) Protein (His) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O43854 |
Target Symbol | EDIL3 |
Synonyms | (Developmentally-regulated endothelial cell locus 1 protein)(Integrin-binding protein DEL1) |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | C-6His |
Target Protein Sequence | DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE |
Expression Range | 24-480aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 57.0 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development. |
Subcellular Location | Secreted. |
Database References |
Gene Functions References
- EDIL3 may be implicated in retinal neovascularization in vitro. Silencing EDIL3 expression was demonstrated to impair the proliferative, migratory and tube forming capabilities of HRECs in vitro. PMID: 28765888
- these data reveal an unrecognised function of endogenous Del-1 as a local inhibitor of ischaemia-induced angiogenesis by restraining LFA-1-dependent homing of pro-angiogenic haematopoietic cells to ischaemic tissues PMID: 28447099
- Del-1-induced HSC proliferation and myeloid lineage commitment were mediated by beta3 integrin on hematopoietic progenitors. PMID: 28846069
- Del-1 pre-treatment of blood before addition of islets diminished coagulation activation and islet damage PMID: 26676803
- Del-1 on circulating EVs is a promising marker to improve identification of patients with early-stage breast cancer and distinguish breast cancer from benign breast tumors and noncancerous diseases. PMID: 26603257
- Overexpressed EDIL3 promotes anchorage-independent tumor growth in human pancreatic cancer. PMID: 26735172
- Overexpression of the Del-1 gene potentiates proliferation and invasion of lung carcinoma cells. PMID: 26545781
- The importance of interaction between EDIL3 and integrin alphaV. PMID: 25273699
- The reciprocal regulation between Del-1 and inflammation may contribute to optimally balance the protective and the potentially harmful effects of inflammatory cell recruitment. PMID: 24416060
- Downregulation of developmentally regulated endothelial cell locus-1 inhibits the growth of colon cancer. PMID: 19292890
- Del-1 may act as a gatekeeper of adrenal gland inflammation and may regulate the integrity of the hypothalamic-pituitary-adrenal axis stress response, thereby modulating adrenal (dys)function in the course of SIRS. PMID: 23364949
- database search for EGF domain sequences shows that this RGD finger is likely an evolutionary insertion and unique to the EGF domain of Del-1 PMID: 22601780
- Del-1 mediates phosphatidylserine- and integrin-dependent endothelial uptake of microparticles by endocytosis. PMID: 22388320
- High expression level of EDIL3 predicts poor prognosis of hepatocellular carcinoma patients. PMID: 20857535
- Del1 mediates vascular smooth muscle cell adhesion, migration, and proliferation through interaction with integrin alpha(v)beta(3). PMID: 11959660
- acts as an angiogenic factor in the context of solid tumor formation; the increase in vascularization accelerates tumor growth through decreased apoptosis PMID: 12074641
- Alpha v beta 5, alpha v beta 5 and their ligands Del-1 and L1 play an important role in the process of tumor cells moving from the original place. PMID: 18090124