Recombinant Human Fatty Acid-Binding Protein, Liver (FABP1) Protein (His)

Name: Recombinant Human Fatty Acid-Binding Protein, Liver (FABP1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07864P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant proteins holiday sale

Price Save $493

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Fatty Acid-Binding Protein, Liver (FABP1) Protein (His) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P07148
Target Symbol	FABP1
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-6His
Target Protein Sequence	MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Expression Range	1-127aa
Protein Length	Full length
Mol. Weight	16.2 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
Subcellular Location	Cytoplasm.
Protein Families	Calycin superfamily, Fatty-acid binding protein (FABP) family
Database References	HGNC: 3555 OMIM: 134650 KEGG: hsa:2168 STRING: 9606.ENSP00000295834 UniGene: Hs.380135

Gene Functions References

urinary level associated with the chronic kidney disease classification in HIV-infected patients, but not associated with antiretroviral therapy and tenofovir disoproxil fumarate PMID: 27761670
Both peak oxygen consumption and grip strength were inversely associated with urinary L-FABP levels in middle-aged and older individuals without chronic kidney disease. PMID: 28197733
Nonrenal conditions and systemic severity should be considered for improved AKI prediction by NGAL and L-FABP as biomarkers. PMID: 27605390
urine L-FABP/C is permanently elevated in chronic kidney disease patients. PMID: 28745927
Our data suggests that the polymorphism in genes IL-1beta, IL-1Ra and FABP1 included in this study are not associated with PCOS development, but can influence important biochemical and metabolic parameters in PCOS. PMID: 28405733
On PICU day 1, interleukin-18 predicted acute kidney injury with area under the curve=0.82, but neutrophil gelatinase-associated lipocalin and liver fatty acid binding protein predicted acute kidney injury with area under the curve of less than or equal to 0.69; on PICU day 2, area under the curve was higher. Interleukin-18 and liver fatty acid binding protein on day 1 predicted prolonged acute kidney injury. PMID: 28430754
In total, 68 miRNAs potentially targeting FABP1 were selected; of these, miR-3941, miR-4517, and miR-4672 directly targeted the FABP1 3' untranslated region. Mimics of the three miRNAs substantially repressed FABP1 expression at translational level and led to HepG2 cell resistance to steatosis and cell injury induced by free fatty acids mixture, which rescue of FABP1 overexpression reversed. PMID: 29258109
This study demonstrated that the loss of FABP1 expression is associated with MSI carcinomas and that interferon gamma stimulation plays a role in this process via its interaction with PPARgamma. PMID: 27687006
Hepatic adenomas co-occurring with fibrolamellar carcinomas show LFABP loss and are negative for PRKACA rearrangements, indicating they are genetically distinct lesions. These data also demonstrate that LFABP loss, which characterizes HNF1-alpha inactivation, is a consistent feature of fibrolamellar carcinoma, indicating HNF1-alpha inactivation is an important event in fibrolamellar carcinoma pathogenesis. PMID: 27015136
studies indicate that FABP1 is essential for proper lipid metabolism in differentiated enterocytes, particularly concerning fatty acids uptake and its basolateral secretion. PMID: 28919479
CDH5 and FABP1 expression levels were both elevated in drug-induced liver injury. PMID: 27224670
A high resolution NMR comparative molecular analysis of L-FABP T94T and L-FABP T94A in their unbound states and in the presence of representative ligands of the fatty acid and bile acid classes showed that threonine to alanine replacement did not result in strongly perturbed structural and dynamic features, although differences in oleic acid binding by the two variants were detected. PMID: 28668637
Studies show that despite overall tertiary structure similarity, the hFABP1 differs significantly from rat FABP1 in secondary structure, much larger ligand binding cavity, and affinities/specificities for some ligands. Moreover, while both mouse and hFABP1 mediate ligand induction of PPARA, they differ markedly in genes induced. hFABP1 T94A variant is associated with altered body mass index.[review] PMID: 27117865
analysis of structural, dynamic, and binding properties of the liver fatty acid binding protein (LFABP) in crowded solutions PMID: 27457417
Urinary L-FABP, NGAL, Kim-1 and albumin levels increased during the acute phase of kidney injury and were significantly correlated with the degree of tubulointerstitial fibrosis during the chronic phase. These markers could detect higher risk of progression to CKD. PMID: 27028054
L-FABP was found to associate with VEGFR2 on membrane rafts and subsequently activate the Akt/mTOR/P70S6K/4EBP1 and Src/FAK/cdc42 pathways, which resulted in up-regulation of VEGF-A accompanied by an increase in both angiogenic potential and migration activity. L-FABP significantly promoted tumor growth and metastasis in a xenograft mouse model. PMID: 26919097
In chronic kidney disease, high urinary L-FABP correlated with the development of end-stage renal disease and cardiovascular disease. PMID: 26189083
In the association of SNPs in FABP1 gene with PCOS, rs2197076 was more closely associated with its main features than rs2241883 and seemed to play a more important role in the pathogenesis of PCOS. PMID: 26650609
Report interaction of perfluoroalkyl acids with human liver fatty acid-binding protein. PMID: 25370009
Urinary L-FABP appears to be a sensitive biomarker of acute kidney injury in patients undergoing abdominal aortic repair. PMID: 26585768
Urinary levels of NGAL are more sensitive than uKIM-1 and uL-FABP levels in predicting renal scarring in vesicoureteral reflux. PMID: 26324091
Loss of staining for LFABP appears to be common in hepatocellular carcinoma and may be seen in well-differentiated hepatocellular carcinoma. PMID: 26997447
In this study, the effects of hepatitis B virus X protein (HBx) mediated FABP1 regulation on hepatic steatosis and the underlying mechanism were determined. PMID: 26637457
compared with the rs2919872 G allele, the rs2919872 A allele reduces the transcriptional activity of FABP1 promoter, and thereby may link FABP1 gene variation to triglyceride level in humans. PMID: 26439934
Higher urinary L-FABP was found in pregnant with and without gestational diabetes mellitus(GDM), and considerably higher urinary L-FABP was found in the GDM group compared with the non-GDM group. PMID: 26254248
Multivariable regression analysis revealed that urinary L-FABP and urinary albumin/ creatinine ratio were significantly associated with urinary ACE2 levels. PMID: 26067610
Measurement of uL-FABP levels at 48 h after coronary angiography may be useful in detecting renal damage, and in predicting 1-year renal outcome in ischemic heart disease patients undergoing CAG. PMID: 24554034
Measurement of urinary L-FABP and albumin/creatinine ratio should be useful to assess cardiovascular damage reflecting the elevation of cardiac markers and ECG abnormalities in T2DM with CKD. PMID: 24626813
Urinary L-FABP is strongly associated with anemia in non-diabetic patients. PMID: 26010898
L-FABP is a novel biomarker of diverse kidney diseases. (Review) PMID: 25797895
I-FABP and L-FABP are early markers for abdominal injury with limited prognostic value for secondary organ failures in the post-traumatic course PMID: 25324448
Both the MTP I128T and the L-FABP T94A polymorphisms can affect serum lipid levels in the Chinese population. PMID: 25663234
The study investigates the interaction of L-FAB with phospholipid liposomes. PMID: 25198387
The human FABP1 T94A variant protein had 3-fold higher cholesterol-binding affinity than the WT FABP1. PMID: 25732850
In smaller HCC, L-FABP downregulation probably occurs because of phenotypic changes during tumor progression. Moreover, this downregulation correlated with tumor differentiation and intratumoral inflammation. PMID: 25516669
FABP1 and FABP2 have roles in differentially modulating the activation of PPARalpha in a ligand-selective manner PMID: 25847235
Maternal serum LFABP level appears to be correlated with the severity of the preeclampsia and can be used to confirm the diagnosis. PMID: 25399315
Data suggest that up-regulation of urinary levels of LFABP, KIM1 (kidney injury molecule 1), and NGAL (neutrophil gelatinase associated lipocalin) can be used as biomarkers to reflect tubular dysfunction in early-stage type 2 diabetic nephropathy. PMID: 24687388
There is not a significant association between the FABP1 polymorphisms and aspirin-exacerbated respiratory disease(AERD). PMID: 25338211
Urinary L-FABP was an accurate predictor of early renal allograft function. PMID: 25027586
Increased serum L-FABP levels are associated with delayed graft function. PMID: 24750195
Baseline urinary L-FABP levels can be a predictor for occurrence of contrast-induced kidney disease. PMID: 23604313
L-FABP was downregulated in hepatocellular carcinoma and was associated with poor prognosis. PMID: 25436304
It has investigated the interaction between human L-FABP and the soluble domain of Plasmodium falciparum UIS3 by NMR spectroscopy. PMID: 23169100
NGAL, IL-18, KIM-1, L-FABP, and albumin differed between etiologies and were significantly higher in patients adjudicated with acute kidney injury. PMID: 24375576
Human FABP1 T94A variant impacts fatty acid metabolism and PPAR-alpha activation in cultured human female hepatocytes. PMID: 24875102
although the T94A substitution did not alter the affinity of human L-FABP for long chain fatty acids, it significantly altered human L-FABP structure and stability PMID: 24628888
Data suggest that an SNP in FABP1 (T94A) does not alter affinity of FABP1 for PPARalpha agonists (fibrates); this SNP does alter FABP1 secondary structure, stability, and functional response to fibrates (gene expression up-regulation in hepatocytes). PMID: 24299557
L-FABP was not significantly associated with acute kidney injury in adults or children after adjusting for other kidney injury biomarkers (neutrophil gelatinase-associated lipocalin and IL-18). PMID: 23599408
MS and NMR were used to study the ligand binding of human liver fatty acid binding protein. Results are consistent for 2 binding sites with different affinity; results indicate a higher affinity for oleate relative to palmitate at each binding site. PMID: 23893635

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.