Recombinant Human Folate Receptor Beta (FOLR2) Protein (His)

Name: Recombinant Human Folate Receptor Beta (FOLR2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02144P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins holiday sale

Price Save $587

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Folate Receptor Beta (FOLR2) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P14207
Target Symbol	FOLR2
Synonyms	beta hFR; FBP; FBP/PL 1; FBP2; fetal/placental; folate receptor 2 (fetal); Folate receptor 2; Folate receptor; Folate receptor beta; Folate receptor; fetal/placental; Folbp 2; Folbp2; Folr2; FOLR2_HUMAN; FR beta; FR P3; FR-beta; Placental folate binding protein; Placental folate-binding protein
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-10His
Target Protein Sequence	CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
Expression Range	19-230aa
Protein Length	Partial
Mol. Weight	27.1 kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor. Secreted.
Protein Families	Folate receptor family
Database References	HGNC: 3793 OMIM: 136425 KEGG: hsa:2350 STRING: 9606.ENSP00000298223 UniGene: Hs.433159
Tissue Specificity	Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.

Gene Functions References

Folate receptor beta as a novel CD11b/CD18 regulator for trafficking and homing of a subset of macrophages on collagen. PMID: 27534550
FR-beta expression was low or absent in the majority of ovarian, breast and colorectal tumor samples. PMID: 26248049
FR-beta is uniquely expressed on this proinflammatory subpopulation offers a new strategy to suppress migration of inflammatory monocytes into sites of inflammation. PMID: 25015955
High FOLR2 mRNA expression is associated with uraemic patients on hemodialysis. PMID: 23439585
severe pre-eclampsia is associated with decreased placental expression of FR-beta and a reduction in the number of fetal macrophages (Hofbauer cells) PMID: 23480364
Expression of folate receptor-beta on activated macrophages holds a promising potential for early diagnosis of atherosclerosis. (Review) PMID: 22094710
High Folate Receptor beta expressing tumor-associated macrophages are associated with pancreatic cancer. PMID: 22350599
Functional FR-beta present on osteoarthritis synovial macrophages provides a potential tool for the diagnosis and treatment of this disease. PMID: 22211358
study describes that functional FRbeta is specifically expressed by M-CSF-polarized (M2) macrophages as well as by ex vivo isolated tumor-associated macrophages, and that tumors induce its expression in an M-CSF-dependent manner PMID: 19951991
FR-beta gene is a target for multiple coordinate actions of nuclear receptors for ATRA directly and indirectly acting on a transcriptional complex containing activating Sp1/ets and inhibitory AP-1 proteins. PMID: 12543860

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.