Recombinant Human Hla Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05779P
Recombinant Human Hla Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05779P
Regular price
$40700
$407.00
Sale price$29900
$299.00Save $108
/
Product Overview
Description | Recombinant Human Hla Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2 μg/mL can bind Anti-CD74 recombinant antibody , the EC 50 is 1.317-1.646 ng/mL. |
Uniprotkb | P04233 |
Target Symbol | CD74 |
Synonyms | (HLA-DR antigens-associated invariant chain)(Ia antigen-associated invariant chain)(Ii)(CD antigen CD74) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-10His |
Target Protein Sequence | QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM |
Expression Range | 73-232aa |
Protein Length | Partial of Isoform 2 |
Mol. Weight | 21.0 kDa |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.; Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.; Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2. Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform. |
Subcellular Location | Cell membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus, trans-Golgi network. Endosome. Lysosome. Note=Transits through a number of intracellular compartments in the endocytic pathway. It can either undergo proteolysis or reach the cell membrane.; [Isoform p41]: Late endosome. Lysosome. |
Database References | |
Associated Diseases | A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74-ROS1 chimeric protein. |
Tissue Specificity | [Isoform p41]: In B cells, represents 10% of total CD74 expression.; [Isoform p33]: In B cells, represents 70% of total CD74 expression. |
Gene Functions References
- High CD74 expression is associated with progressive multiple sclerosis. PMID: 28923927
- These findings predict the binding mode of Hu-MIF-1 and orthologs with CD74. PMID: 28513076
- results suggest that two immune biomarkers, CD74 and IL10, could be relevant tools for the identification of Intensive care unit-acquired infections risk in Intensive care unit patients. PMID: 28477143
- Increased CD74 expression levels predicted worse stroke severity and outcomes in subjects with ischemic stroke. PMID: 27884769
- The data validate CD74 as a useful prognostic tumor cell protein marker associated with favorable recurrence-free survival and overall survival in stage III melanoma. PMID: 26783288
- These results have implications for the manner in which D-DT and MIF compete with each other for binding to the CD74 receptor and for the relative potency of DRa1-MOG-35-55 and RTL1000 for competitive inhibition of D-DT and MIF binding and activation through CD74. PMID: 27573366
- CLIP expression and activated gamma-delta T cells are responsible for the development of preeclampsia. PMID: 28642294
- these observations are consistent with the view that CD74 expression in tumor cells promotes the intratumoral immune response and is associated with a better prognosis in basal-like breast cancer PMID: 27058619
- MIF-CD74 signaling inhibits interferon (IFN)-gamma secretion in microglia through phosphorylation of microglial ERK1/2 (extracellular signal-regulated protein kinases 1 and 2). The inhibition of MIF signaling or its receptor CD74 promotes IFN-gamma release and amplifies tumor death either through pharmacological inhibition or through siRNA-mediated knockdown. PMID: 27157615
- High CD74 expression is associated with colorectal cancer. PMID: 27599658
- the roles of CD74 and MIF in the immune surveillance escape process PMID: 26866879
- CD74 downregulation in placental macrophages is present in preeclampsia. PMID: 27199465
- CD74 was increased in burn patients. PMID: 27209369
- predicted binding of one CD74 trimer to a single RTL1000 antagonist utilized the same two 5 residue determinants PMID: 26851955
- an inverse correlation with the tumor size for stromal MIF and a positive correlation with the triple receptor negative tumor status for stromal CD74 seem to be showed PMID: 26412712
- Studies indicate that the invariant chain (CD74) is critical for antigen presentation. PMID: 27033518
- FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74. PMID: 26500140
- Interferon gamma promotes melanoma cell survival regulating CD74-MIF interaction. PMID: 26039541
- The results of this stusy suggested that the CD74 represents a positive prognostic marker most probably because of its association with an M1-polarized immune milieu in high-grade gliomas. PMID: 25175718
- Invariant chain is a new chaperone for TLR7 in B cells. (Review) PMID: 26198699
- CD74 expression and its therapeutic potential in thyroid carcinoma PMID: 25600560
- Specific targeting of the CD74 on the lymphoma cell surface will sensitize CD74-expressing cancer cells to Fas-mediated apoptosis. PMID: 25304249
- A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2. PMID: 25983110
- these results demonstrate that the subunit stoichiometry of oligomeric Ii/MHCII complexes is influenced by p35. PMID: 24638068
- Findings showed an increased extent of MIF expression in cancer cells and in stromal fibroblasts of Breast Cancer tumor, in contrast to a less uniform increase of CD74 expression. PMID: 24939415
- In human B cells, SPPL2a is indispensable for turnover of CD74 N-terminal fragment. PMID: 25035924
- Results show that CD74-NRG1 gene fusions are activating genomic alterations in invasive mucinous lung adenocarcinomas. PMID: 24469108
- In TPA-induced skin inflammation, MIF is released from damaged keratinocytes and then triggers the chemotaxis of CD74(+)CXCR2(+) NKT cells for IFN-gamma production. PMID: 25172501
- Data show that clear cell renal cell carcinoma (ccRCC) tissue and malignant cell lines expressed higher levels of CD74 and hypoxia inducible factor 1alpha (HIF-1alpha) than adjacent normal renal tissue and normal cell HK-2. PMID: 23273913
- Polymorphisms in CD74 is associated with hematologic toxicity in patients with non-small-cell lung cancer after platinum-based chemotherapy. PMID: 24220096
- MIF/CD74 pathway may represent a crucial target for treating disc degeneration since inhibiting the function of MIF with its antagonist ISO-1 can reduce MIF-induced inflammation and exert potent therapeutic effects. PMID: 24569872
- demonstrate that CLIP expression on leukemia-associated phenotype (LAP)-positive cells during follow-up is significantly correlated with a shortened relapse-free survival PMID: 24731748
- High CD74 expression is associated with head and neck squamous cell carcinomas. PMID: 24663824
- High expression of CD74 is an independent prognostic factor for prolonged overall survival in mesothelioma patients PMID: 24594996
- These results demonstrate natural antagonist activity of DRalpha1 for macrophage migration inhibitory factor PMID: 24683185
- Recombinant vaccinia virus vaccines encoding CD74 may be useful tools to improve CD4 T-cell responses to viral and tumour antigens. PMID: 24205828
- when CD74 is overexpressed in human cancer and noncancerous epithelial cells, it interacts and interferes with the function of Scribble PMID: 23730214
- Evaluated expression of CD74 in chronic lymphocytic leukemia patients. CD74 expression was significantly higher in CLL group than in controls. There was positive correlation between CD74 and ZAP70 expression. PMID: 23572149
- Our data do not replicate prior reports of LN-2 as a sensitive and specific marker for undifferentiated pleomorphic sarcoma PMID: 23000905
- CD74 antigen expression is increased in high grade, invasive urothelial bladder cancer. PMID: 22905972
- Ii regulates the repertoire of tumor peptides presented by major histocompatibility complex class II+ breast cancer cells. PMID: 22942358
- Data show that human Iip35 isoform (CD74 antigen) is expressed in mouse antigen presenting cells. PMID: 22689013
- Data indicate that 25 +/- 1.3% of CD74 and 17 +/- 0.3% of HLA-DR are colocalized. PMID: 22889831
- a novel regulatory mechanism governing cell migration during intervertebral disc degeneration PMID: 22952837
- High Cd74 expression is associated with lymph node metastasis and triple-negative breast cancer. PMID: 22935920
- Hepatitis C virus-mediated inhibition of cathepsin S increases invariant-chain expression on hepatocyte surface. PMID: 22761382
- Expression of CD74-ROS in noninvasive NSCLC cell lines readily conferred invasive properties that paralleled the acquisition of E-Syt1 phosphorylation. PMID: 22659450
- Stat1 and CD74 overexpression is co-dependent and linked to increased invasion and lymph node metastasis in triple-negative breast cancer. PMID: 22178447
- Upregulation of MIF, CD74 and TLR4 are associated with increasing clinical stage and provide an opportunity as novel gastric cancer chemoprevention and/or treatment strategy. PMID: 22611320
- This is the first study reporting that Ii chain up-regulation occurs on naturally infected antigen presenting cells obtained directly from HIV(+) subjects. PMID: 21945129