Recombinant Human Icos Ligand (ICOSLG) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05567P
Recombinant Human Icos Ligand (ICOSLG) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05567P
Regular price
$40700
$407.00
Sale price$29900
$299.00Save $108
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Icos Ligand (ICOSLG) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS , the EC 50 of human ICOSLG protein is 29.04-43.59 ng/ml. |
Uniprotkb | O75144 |
Target Symbol | ICOSLG |
Synonyms | ICOSLG; B7H2; B7RP1; ICOSL; KIAA0653; ICOS ligand; B7 homolog 2; B7-H2; B7-like protein Gl50; B7-related protein 1; B7RP-1; CD antigen CD275 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-6His |
Target Protein Sequence | DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS |
Expression Range | 19-258aa |
Protein Length | Partial |
Mol. Weight | 28.9 kDa |
Research Area | Cancer |
Form | Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, BTN/MOG family |
Database References | |
Tissue Specificity | Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leuko |