Recombinant Human Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Protein (hFc)

Name: Recombinant Human Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Protein (hFc)
Brand: Beta LifeScience
SKU: BLC-00246P
Price: 349.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant proteins holiday sale

Price Save $95

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q16270
Target Symbol	IGFBP7
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Expression Range	27-282aa
Protein Length	Full Length
Mol. Weight	55.4 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
Subcellular Location	Secreted.
Database References	HGNC: 5476 OMIM: 602867 KEGG: hsa:3490 STRING: 9606.ENSP00000295666 UniGene: Hs.479808
Associated Diseases	Retinal arterial macroaneurysm with supravalvular pulmonic stenosis (RAMSVPS)

Gene Functions References

Placenta and appetite genes GDF15 and IGFBP7 are associated with hyperemesis gravidarum. PMID: 29563502
IGFBP7 upregulation promotes osteogenic differentiation of mesenchymal stem cells via the Wnt/beta-catenin signaling. PMID: 29242275
Low IGFBP7 expression is associated with Gastric Cancer. PMID: 29580038
Reduced RNA editing of IGFBP7 gene is associated with psoriasis. PMID: 29592874
Urine levels of IGFBP7 (and TIMP2) are predictive for acute kidney injury following cardiac surgical procedures. PMID: 28803769
IGFBPrP1 transfection inhibited cell growth, and induced G1 phase arrest and cellular senescence in HEC1A cells while gene silencing presented the adverse functional changes. PMID: 29067463
Serum IGFBP7 levels were raised during acute exacerbation in COPD patients. PMID: 28684903
biomarker for acute kidney injury PMID: 27174659
epithelial cells and leukocytes from the urinary sediment. CONCLUSION: The gene expression pattern of IGFBP7 and TIMP-2 from urinary sediment, which contains desquamated renal tubular epithelial cells, did not correlate with [IGFBP7]x[TIMP-2] protein, indicating that IGFBP7 and TIMP-2 measured in the NephroCheck(R) test originated predominantly from intact but stressed cells of the kidney itself PMID: 29145491
In patients with heart failure with preserved ejection fraction, IGFBP7 may be a novel biomarker of diastolic function and exercise capacity. PMID: 27744089
High IGFBP7 expression is associated with acute kidney injury. PMID: 27342580
NEAT1-associated paraspeckle proteins P54nrb and PSF have been reported as positive regulators of c-Myc translation through interaction with c-Myc IRES PMID: 28288210
Urine [TIMP-2]*[IGFBP7] is a promising candidate for early detection of AKI, especially in ruling-out AKI PMID: 28107490
Meta-analysis indicated that urinary [TIMP-2].[IGFBP7] may be a reliable biomarker for the early detection of acute kidney injury in adults. PMID: 28682920
TIMP-2 is both expressed and secreted preferentially by cells of distal tubule origin, while IGFBP7 is equally expressed across tubule cell types yet preferentially secreted by cells of proximal tubule origin. In human kidney tissue, strong staining of IGFBP7 was seen in the luminal brush-border region of a subset of proximal tubule cells, and TIMP-2 stained intracellularly in distal tubules. PMID: 28003188
loss of IGFBP7 and upregulation of IGF1 activates the FGF4-FGFR1-ETS2 pathway in Tumor-associated endothelial cells (TECs) and converts naive tumor cells to chemoresistant tumor stem-like cells (TSCs), thereby facilitating their invasiveness and progression. PMID: 27989801
Data report that IGFBP7 is a novel target gene of ADAR2 in esophageal squamous cell carcinoma where its RNA is edited and protein stabilized by ADAR2. PMID: 28035363
quantitative urine test is available to assess the risk of developing AKI by measuring the concentrations of two protein biomarkers, TIMP-2 and IGFBP-7 PMID: 26797672
Insulin-like growth factor binding protein 7 (IGFBP7) was proven to be associated with metastatic clinicopathological features and high lymphatic vascular density PMID: 26706909
This process not only provides a remarkable high expression at ~50mg/L and pure glycosylated mammalian rhIGFBP7, also highlights that transient gene expression technology is practical to be used for production PMID: 26474694
data suggest that TGF-beta1 enhances IGFBP7 via Smad2/4 pathways, and that IGFBP7 might be involved in the TGF-beta1-induced tubular injury in DN. PMID: 26974954
This study shows that urinary [TIMP-2]*[IGFBP7] has a good diagnostic performance in predicting adverse outcomes in neonatal and pediatric AKI of heterogeneous etiology. PMID: 26606754
low expression in breast cancer tissue PMID: 26387651
serum IGFBP7 levels are associated with IR and MetS, providing new insight into the mechanism of IR and Mets. IGFBP7 may be a potential interventional target for IR and Mets. PMID: 25984973
IGFBP-7 can alter EMT relative marker genes and suppress cell invasion in A253 cell through AKT/GSK3beta/beta-catenin signaling. PMID: 25880247
IGFBP7 down-regulation is associated with poor prognosis in glioma, and this molecule may represent both a prognostic marker and a potential therapeutic target. PMID: 24743871
Our data indicate that IGFBP7 expression is a marker for a specific methylation pattern in myeloma PMID: 25887188
The low levels of IGFBP7 in high-grade serous ovarian carcinoma are associated with survival rate. PMID: 25886299
Overexpression of IGFBP7 was associated with tumour progression and poor survival in gastric cancer. IGFBP7 may play a role in tumour progression in gastric cancer. PMID: 26043748
we demonstrated that IGFBP-rP1 suppresses EMT and tumor metastasis by repressing TGF-b-mediated EMT through the Smad signaling cascade. PMID: 25789970
IGFBP7 in urine was identified as a reliable marker of cell cycle arrest induction in acute kidney injury. PMID: 23388612
The decline in urinary TIMP-2 and IGFBP7 values was the strongest predictor for renal recovery following cardiac surgery. PMID: 24675717
in contrast to its tumor-suppressor function in epithelial cells, IGFPB7 can promote anchorage-independent growth in malignant mesenchymal cells and in epithelial cells with an EMT phenotype when IGFBP7 is expressed by the tumor cells PMID: 24632618
These results suggest that AGM cooperates with VEGF to induce the aberrant functions of cancer vasculature as a ligand of integrin alpha5beta3. PMID: 24737780
AML patients with high IGFBP7 expression have a better outcome than patients with low IGFBP7 expression, indicating a positive role for IGFBP7 in treatment and outcome of AML. PMID: 24967962
Data indicate that insulin-like growth factor binding protein 7 (IGFBP7) was downregulated in gastric cancer, and its low expression was potentially correlated with increased cell proliferation and could be used to predicate poor prognosis in patients. PMID: 24894674
as urinary marker, discriminated between early and late/non-recovery patients and patients with and without acute kidney injury PMID: 24067438
IGFBP-rP1 contributes to the development of liver fibrosis and may be a novel molecule involved in the progression of hepatic fibrogenesis. PMID: 24373620
High expression of IGFBP7 in fibroblasts induced by colorectal cancer cells is co-regulated by TGF-beta and Wnt signaling in a Smad2/3-Dvl2/3-dependent manner. PMID: 24427302
These data suggest that IGFBP7 is a critical regulator of memory consolidation and might be used as a biomarker for AD. PMID: 24075854
Methylation of the IGFBP7 promoter was associated with silencing of gene expression and was frequent in Barrett's oesophagus and oesophageal adenocarcinoma PMID: 24357797
Perfomed proteomic analysis on a transgenic mouse model of severe cardiac hypertrophy; compared data to dataset of heart failure found MYH7, IGFBP7, ANXA2, and DESM to be biomarker candidates for heart failure. PMID: 23713052
Report A-to-I editing in the coding sequence of IGFBP7 in cancerous human keratinocytes. PMID: 23543219
hypomethylation of LINE-1 and hypermethylation of SLIT2, MAL and IGFBP7 were frequently detected in NSCLCs and associated with various clinical features. PMID: 23381221
Results indicate that restoration of IGFBP-rP1 to PC-3 cells increases both their radiosensitivity and chemosensitivity. PMID: 23600329
Low expression of IGFBP7 is associated with pancreatic ductal adenocarcinoma. PMID: 22622471
Hyperinsulinemia and high IGFBP-rP1 levels confer altered risks for endometrial carcinoma. PMID: 22544761
Results demonstrate that CpG methylation of IGFBP7 may represent a novel biomarker of prostate cancer and pre-invasive neoplasms PMID: 22906661
editing of IGFBP7 transcripts impacts the protein's susceptibility to proteolytic cleavage, thus providing a means for a cell to modulate its functionality through A-to-I RNA editing PMID: 22750143
Transfection of IGFBP-rP1 or addition of condition medium (CM) from IGFBP-rP1-transfected cells in MCF-7 cells caused induction of a variety of senescent phenotypes. PMID: 22392074

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.