Recombinant Human Intercellular Adhesion Molecule 1 (ICAM1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03592P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Intercellular Adhesion Molecule 1 (ICAM1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03592P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Intercellular Adhesion Molecule 1 (ICAM1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P05362 |
Target Symbol | ICAM1 |
Synonyms | Antigen identified by monoclonal BB2; BB 2; BB2; CD 54; CD_antigen=CD54; CD54; Cell surface glycoprotein P3.58 ; Human rhinovirus receptor; ICAM 1; ICAM-1; ICAM1; ICAM1_HUMAN; intercellular adhesion molecule 1 (CD54); intercellular adhesion molecule 1 (CD54), human rhinovirus receptor; Intercellular adhesion molecule 1; Major group rhinovirus receptor; MALA 2; MALA2; MyD 10; MyD10; P3.58; Surface antigen of activated B cells; Surface antigen of activated B cells, BB2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE |
Expression Range | 28-480aa |
Protein Length | Partial |
Mol. Weight | 76.5kDa |
Research Area | Cell Adhesion |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.; (Microbial infection) Acts as a receptor for major receptor group rhinovirus A-B capsid proteins.; (Microbial infection) Acts as a receptor for Coxsackievirus A21 capsid proteins.; (Microbial infection) Upon Kaposi's sarcoma-associated herpesvirus/HHV-8 infection, is degraded by viral E3 ubiquitin ligase MIR2, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, ICAM family |
Database References |
Gene Functions References
- miR-335-5p could target 3'UTR of ICAM-1 and inhibit its expression, preventing invasion and metastasis of thyroid cancer cells. PMID: 30119270
- AGEs increase IL-6 and ICAM-1 expression via the RAGE, MAPK and NF-kappaB pathways in HGFs and may exacerbate the progression of the pathogenesis of periodontal diseases. PMID: 29193068
- Our meta-analyses provide no evidence of the association of ICAM-1 rs5498 with diabetic retinopathy in type 2 diabetic patients. PMID: 30419874
- CORM-2 inhibits P. aeruginosa-induced PGE2/IL-6/ICAM-1 expression and lung inflammatory responses by reducing the Reactive Oxygen Species generation and the inflammatory pathways. PMID: 30007888
- Smooth muscle cell-derived bioactive soluble factors may stimulate the ICAM-1 expression of cocultured endothelial cells, possibly leading to leukocyte migration into the subendothelial space. PMID: 29852173
- These results together with the authors' previous study, have identified that CNOT1 provides a platform for the recruitment of TTP and CNOT7, and is involved in TTPmediated ICAM1 and IL8 mRNA decay. PMID: 29956766
- ICAM-1 expression is not significantly linked to metastatic disease in pancreatic ductal adenocarcinoma. PMID: 29355490
- In conclusion, this meta-analysis indicates that ICAM-1 gene rs5498 polymorphism decreases the risk of CAD PMID: 30290609
- Data suggest that serum levels of soluble ICAM1 are higher in young adults with reduced physical activity as compared to young adults who participate in optimal physical activity. This study was conducted in Bulgaria with medical and dental students aged 20 +/-2 years. PMID: 29183155
- TNF-alpha and IL-10 treatment can affect the expression of ICAM-1 and CD31 in human coronary artery endothelial cells. PMID: 29949812
- not a specific screening marker for pulmonary arterial hypertension in systemic sclerosis PMID: 29687288
- The ICAM-1 expression level determines the susceptibility of human endothelial cells to simulated microgravity. PMID: 29080356
- the combination of IL-6 -572C/G and ICAM-1 K469E polymorphisms have a synergistic effect on the onset of Sudden sensorineural hearing loss. PMID: 29695657
- Peripheral blood lymphocyte subsets in patients with lung cancer are different from those in healthy people, and circulating CD44+ and CD54+ lymphocytes seem to be a promising criterion to predict survival in lung cancer patients undergoing chemotherapy PMID: 29148014
- serum ICAM-1 levels were associated with type 2 diabetes mellitus with microalbuminuria leading to severity of diabetic kidney disease. PMID: 29310968
- Serum CCL2 and sICAM-1 concentrations were significantly decreased in CNS tumors in comparison with the comparative group. Among proteins tested in the serum, a higher area under the ROC curve (AUC) revealed CCL2 compared to sICAM-1 in differentiating subjects with CNS brain tumors from non-tumoral subjects. PMID: 29086194
- Patient-derived ATC cells overexpressed ICAM-1 and were largely eliminated by autologous ICAM-1 CAR T cells in vitro and in animal models. Our findings are the first demonstration of CAR T therapy against both a metastatic, thyroid cancer cell line and advanced ATC patient-derived tumors that exhibit dramatic therapeutic efficacy and survival benefit in animal studies PMID: 29025766
- Data indicate ICAM-1 as an essential receptor for both acute hemorrhagic conjunctivitis (AHC)-causing and non-AHC strains. PMID: 29284752
- The results of cell adhesion and western blotting assays demonstrated that arachidin-1 attenuated tumor necrosis factor (TNF)-alpha-induced monocyte/EC adhesion and intercellular adhesion molecule-1 (ICAM-1) expression PMID: 29115410
- anthropometric and physiological parameters do not affect the response of ICAM-1 to exercise in healthy men. PMID: 29696063
- 15-LOX-1 expression in colon and prostate cancer cells leads to reduced angiogenesis. These changes could be mediated by an increase in the expression of both ICAM-1 and the anti-angiogenic protein TSP-1. PMID: 28757355
- Single nucleotide polymorphisms in ICAM1 (rs1799969) and SERPINB2 (rs6103) genes were found to be protective against thalidomide-induced peripheral neuropathy (TiPN). In children with inflammatory bowel disease, TiPN is common but mild and generally reversible. Cumulative dose seems to be the most relevant risk factor, whereas polymorphisms in genes involved in neuronal inflammation may be protective. PMID: 28817461
- analysis of aberrant DNA methylation and hydroxymethylation of the ICAM1 gene promoter in the thyrocytes of Autoimmune Thyroiditis patients PMID: 28388873
- Authors demonstrate that the membrane-bound ICAM-1 isoform is necessary and sufficient to promote inflammation-dependent extracellular matrix contraction, which favors cancer cell invasion. Indeed, ICAM-1 mediates generation of acto-myosin contractility downstream of the Src kinases in stromal fibroblasts. PMID: 27901489
- Thrombin activated platelet releasing exosomes convey miRNA between cells. miRNA-223 regulates the expression of molecules adhesion including ICAM-1. miRNA-223 downregulated ICAM-1 mainly by impacting NF-kappaB and the MAPK pathway. PMID: 28460288
- Data suggest that obese children/adolescents have increased circulating biomarkers of endothelial dysfunction (here, ICAM1) and early signs of renal damage, similarly to children/adolescents with type 1 diabetes (T1D), confirming obesity to be a cardiovascular risk factor as is T1D. PMID: 27246625
- ICAM-1 (and IL-17) polymorphisms showed significant association with Guillian-Barre syndrome. PMID: 27595159
- Airway ICAM-1 expression is markedly upregulated in CAL group, which could be crucial in rhinoviral and NTHi infections. The parenchymal ICAM-1 is affected by smoking, with no further enhancement in CAL subjects. PMID: 28056984
- sVCAM-1 reflects xerostomia in primary Sjogren's syndrome. sICAM-1 and sE-selectin may be additional parameters of secondary Sjogren's syndrome activity. PMID: 29068581
- Atorvastatin strengthens Skp2 binding to FOXO1 or ICAM1, leading to ubiquitination and degradation. Skp2-dependent ubiquitination of major pathogenic molecules is the key mechanism for statin's protective effect on endothelial function in diabetes. PMID: 28802579
- Augmented expression of endothelial adhesion molecules ICAM1/VCAM1 is involved in the pathophysiology of patients with antiphospholipid syndrome. PMID: 29096830
- CD133(+) CD44(+) CD54(+) cellular subpopulation of circulating tumor cells has a prognostic value in colorectal cancer patients with liver metastasis, especially in the survival of CRC patients with liver metastasis who did not undergo surgical treatment for metastasis. PMID: 29105339
- Data suggest that the residue volume at phenylalanine (Phe) in alpha1-helix is critical for alpha(L)/beta(2) integrin (CD49a/CD18) activation and binding with soluble/immobilized ICAM1 (intercellular cell adhesion molecule 1). PMID: 29079572
- Elevated serum uric acid concentration is significantly associated with inflammation of maternal systemic vasculature as indicated by increased TNF-alpha and ICAM-1 expression in women with preeclampsia. PMID: 26511169
- associated with hypertension and stroke risk in women PMID: 27235695
- Data indicate that CDH11, ICAM1 and CLDN3 were overexpressed in tumors when compared to normal esophagus, normal gastric and non-dysplastic Barrett's. PMID: 27363029
- High levels of serum ICAM-1 was associated with the development of multiple organ failure . High levels of VCAM-1 was associated with both multiple organ failure and in-hospital mortality. PMID: 27701021
- matrix stiffness-dependent ICAM-1 clustering is an important regulator of vascular inflammation PMID: 27444067
- PD increased CKIP-1 and Nrf2 levels in the kidney tissues as well as improved the anti-oxidative effect and renal dysfunction of diabetic mice, which eventually reversed the up-regulation of FN and ICAM-1 PMID: 28286065
- PTPN22 colocalized with its substrates at the leading edge of cells migrating on surfaces coated with the LFA-1 ligand intercellular adhesion molecule-1 (ICAM-1). PMID: 27703032
- These results suggest that SHP-2-via association with ICAM-1-mediates ICAM-1-induced Src activation and modulates VE-cadherin switching association with ICAM-1 or actin, thereby negatively regulating neutrophil adhesion to endothelial cells and enhancing their transendothelial migration. PMID: 28701303
- Although there was no association between sICAM-1 levels and affective temperament scores, sICAM-1 was related to the state severity of manic symptoms. PMID: 27693464
- It is a pro-inflammatory protein. PMID: 28390825
- HPMCs are capable of inhibiting growth of gastrointestinal tumors in a mechanism involving the anti-adhesive capabilities of sICAM-1 PMID: 28323210
- Following transepithelial migration, neutrophils adhesion to ICAM-1 resulted in activation of Akt and beta-catenin signaling, increased epithelial-cell proliferation, and wound healing. PMID: 26732677
- P-Selectin and ICAM-1 have roles in mediating THP-1 monocyte adhesion PMID: 28262902
- Dissection of the molecular mechanism revealed that the p38-Notch1 axis was the main downstream signaling pathway in CD54-mediated regulation of cancer stem cells in prostate cancers. PMID: 28042317
- We show that knockdown of the expression of mcircRasGEF1B reduces LPS-induced ICAM-1 expression. Additionally, we demonstrate that mcircRasGEF1B regulates the stability of mature ICAM-1 mRNAs. PMID: 27362560
- his study shows that two adhesion molecules, shed as soluble forms, are elevated during the acute phase of leptospirosis: E-selectin and s-ICAM1. These molecules may interfere with the process of immune cell recruitment to clear Leptospira at tissue levels. PMID: 28686648
- data suggest that CD2AP acts as a negative regulator of ICAM-1 clustering, which limits the formation of ICAM-1 adhesion complexes to prevent uncontrolled neutrophil adhesion and transcellular transmigration. PMID: 28484055