Recombinant Human Interleukin-10 (IL10) Protein (His)

Beta LifeScience SKU/CAT #: BLC-06339P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Interleukin-10 (IL10) Protein (His)

Beta LifeScience SKU/CAT #: BLC-06339P
Regular price $492.00 Sale price $299.00Save $193
/
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-10 (IL10) Protein (His) is produced by our Mammalian cell expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P22301
Target Symbol IL10
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag C-6His
Target Protein Sequence SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Expression Range 19-178aa
Protein Length Full Length of Mature Protein
Mol. Weight 20.9 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling.
Subcellular Location Secreted.
Protein Families IL-10 family
Database References
Tissue Specificity Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.

Gene Functions References

  1. Autocrine IL10 regulates Op18/stathmin signaling via an IL10NFkappaBERK/CDC2 axis. PMID: 30320402
  2. CD163(+)CD204(+) Tumor-associated macrophages possibly play a key role in the invasion and metastasis of oral squamous cell carcinoma by T-cell regulation via IL-10 and PD-L1 production. PMID: 28496107
  3. study showed that the rs1800872 A allele of the IL-10 gene may contribute to the genetic susceptibility of Behcet's disease by regulating the expression of IL-10. PMID: 29294320
  4. study indicates that anti-inflammatory macrophage function and mucosal immune tolerance require both WASP and DOCK8, and that IL-10 signalling modulates a WASP-DOCK8 complex PMID: 29725003
  5. This study demonstrated the alteration of IL-10 levels in aseptic non-vasculitic cerebral sinovenous thrombosis PMID: 30246697
  6. The interleukin-10 gene promoter rs1800872 single nucleotide polymorphism is associated with predisposition to chronic hepatitis C in case of infection with hepatitis C virus 1b genotype in the Russian population. PMID: 29247709
  7. Mycobacterium tuberculosis infection disturbs the HDAC6/HDAC11 levels to induce IL-10 expression in macrophages. PMID: 29523311
  8. The results of this meta-analysis indicated that there is no association between the IL-10 -592 A/C promoter polymorphism and gastrointestinal tract cancer susceptibility. PMID: 29720026
  9. Low IL10 expression is associated with dyslipidaemia, high blood pressure and glucose intolerance. PMID: 29615317
  10. Regulatory polymorphism in the IL-10 gene promoter has a possible and significant association with severity and outcome in patients with acute viral hepatitis, and acute liver failure PMID: 30109600
  11. These results demonstrate that monocyte derived IL-10 acts to inhibit potentially protective cell mediated immune responses against B. pseudomallei, but may also moderate the pathological effects of excessive cytokine production during sepsis. PMID: 28216665
  12. Individuals with posttraumatic stress disorder showed a significant increase in the serum levels of IL-10 (and IL-6). PMID: 29179015
  13. IL-10 SNP at -819 was associated with enhanced AML risk, suggesting that rs1800871 provides clue for future studies and early detection of Acute myeloid leukemia . PMID: 30197353
  14. Although IL-10 promoter polymorphisms are not associated with P. falciparum and S. haematobium co-infection, variant -1082G/A and haplotype GCC are associated with malaria, whereas the IL-10 haplotypes GCC and GTA are associated with schistosomiasis. PMID: 29131459
  15. high IL-10 in rheumatoid arthritis is associated with increased depressive symptoms PMID: 30148175
  16. besides the NF-kappaB pathway, the mechanism of action of FGF-21 was observed to involve the elevation of IL-10 in the ERK1/2 pathway. PMID: 29427162
  17. meta-analysis strongly suggests that the IL10 rs1800896, rs1800871, and rs1800872 polymorphisms are not associated with the risk of autoimmune liver disease PMID: 29694797
  18. Single nucleotide polymorphisms (SNPs) rs12979860 and rs8099917 (IL28B) and rs1800896, rs1800871, and rs1800872 (IL10) are related to treatment outcome, but previous studies clustered nonresponse and relapse patients.Frequency of rs12979860 and rs8099917 is different between relapsers and nonresponders, but similar between relapsers and responders PMID: 29888255
  19. The aim of this study was to explore the possible correlations of serum interleukins and soluble ST2 (sST2) protein with clinical features and inflammatory cytokines in rheumatoid arthritis (RA) patients. PMID: 29798971
  20. Anti-inflammatory cytokines, IL-10 and TGF-beta1, are not upregulated in the serum of patients with juvenile idiopathic arthritis. PMID: 29494710
  21. Overall, no significant association between IL-10 -592 A/C polymorphism and Kawasaki disease risk was found under allele contrast. The IL-10 -592 A/C polymorphism was not associated with Kawasaki disease risk in the Chinese population. PMID: 29656715
  22. These results suggest that the IL-10 -1082 G/A polymorphism confers susceptibility to juvenile idiopathic arthritis. PMID: 29748155
  23. Data show that multiple sclerosis TH1/17 cells have reduced expression of interleukin 10 (IL10) compared to healthy controls. PMID: 29150604
  24. High IL10 and Tumor necrosis factor-alpha expression is associated with coronary artery disease. PMID: 28988596
  25. Results discovered that plasma IL-10 levels in acute respiratory distress syndrome patients were correlated with severity of illness during extracorporeal membrane oxygenation institution. Also, high interleukin-10 was found to be associated to two polymorphic nucleotides at the gene promoter area. PMID: 28432351
  26. association of gene polymorphism (-819C > T, -592C > A and -1082G > A) with preterm birth PMID: 29147889
  27. Suggest that the IL-10 -819T/T variant and the ATA haplotype, which are associated with low production of IL 10, represent genetic risk factors for preeclampsia in Tunisian women. PMID: 29523264
  28. The IL-10 rs1800890 variant might contribute to RA susceptibility in the Chinese population. PMID: 29487192
  29. findings support the hypothesis that the -1082A>G polymorphism in the IL10 gene might be associated with diabetic kidney disease in white Brazilians with type 2 diabetes. PMID: 29227971
  30. This study showed that the activated FcgammaRII(low/-) B cells from HCC tumours, but not the resting FcgammaRII(high) B cells, without external stimulation suppress autologous tumour-specific cytotoxic T-cell immunity via IL-10 signals. PMID: 27853178
  31. It was shown that the expression of CD274, Il-10, and FOXP3 was closely correlated with the clinical characteristics of laryngeal squamous cell carcinoma, including lymph node metastasis and prognosis. PMID: 29257349
  32. IL-10 mRNA levels in peripheral B cells were significantly higher in lung cancer patients.A negative correlation was identified between miR-98 and IL-10 in peripheral B cells. PMID: 27605397
  33. These findings added to the accumulating evidence that promoter haplotypes of IL-10 may be important modulators of the development of amnestic mild cognitive impairment PMID: 29201645
  34. Findings suggest that the combinatorial complexity of TNFA and IL10 promoter polymorphisms impacts systemic lupus erythematosus susceptibility. PMID: 29298134
  35. The combination of IL10 and DAO SNPs in a multivariate model did not alter the OR values. PMID: 28750137
  36. The results indicate that IL10-1082 A/G polymorphism is associated with genetic susceptibility/predisposition to Rheumatoid arthritis in North Indian population. PMID: 29621504
  37. IL-33 increased IL-10 expression in MFCs via activating ERK 1/2 and STAT3, which subsequently promoted IL-10 transcription and thus contributed to the beneficial effects of IL-33 on MFCs. PMID: 29099095
  38. theses results suggest that IL-10 genotypes of recipient are the most associated with the risk of complications after haematopoietic stem cell transplantation PMID: 28987962
  39. Our results suggest that genetic variation in IL-10 gene is unlikely to confer susceptibility to Henoch-Schonlein purpura in Chinese children. PMID: 28963667
  40. neither allele nor genotype frequencies of IL-10 polymorphisms were associated with inflammatory bowel disease in Iranian patients PMID: 28872970
  41. According to our data, TNF A -238G>A and IL-10 -1082A>G, -819C>T and -592C>A may be associated with the development of prostate cancer and BPH. We could also notice higher frequency of TNF A and IL-10 risk haplotypes in smoker and alcohol user. Interestingly, IL-10 risk haplotype was positively associated with aggressiveness of tumor. PMID: 28993831
  42. Local IL-10 and IL-13 upregulation in IgG4-abdominal aortic aneurysms was related to Th2 and Treg-predominant cytokine balance. PMID: 28434701
  43. Suggest that the interaction between macrophages and endometrial stromal cells downregulates cytotoxicity of NK cells possibly by stimulating the secretion of IL-10 and TGF-beta, and may further trigger the immune escape of ectopic fragments and promote the occurrence and the development of endometriosis. PMID: 28971893
  44. isatuximab decreases multiple myeloma cell- and bone marrow stromal cell-induced iTreg by inhibiting both cell-cell contact and TGFbeta/IL10. Finally, CD38 levels correlate with differential inhibition by isatuximab of Tregs from multiple myeloma versus normal donors.Targeting CD38 by isatuximab can preferentially block immunosuppressive Tregs and thereby restore immune effector function against multiple myeloma PMID: 28249894
  45. Activation of PAR2 inhibits the expression of IL-10 in B cells, which can be reversed by treating B cells with Bcl2L12 shRNA-carrying liposomes. PMID: 28426164
  46. Serum IL-17 and IL-23 values positively correlated with serum total IgE levels. Serum levels of IL-10 were lower in children with atopy and dyslipidemia than patients with dyslipidemia. PMID: 28692864
  47. This meta-analysis concludes that IL-10 -1082 gene polymorphism is not significantly associated with overall, Asian and African population. However, this polymorphism is associated with Caucasian population. PMID: 28951522
  48. The data suggest that IL-10, but not IL-37, may have potential as a biomarker predictive for disease activity in Systemic lupus erythematosus. PMID: 27708376
  49. In the study, 250 ONFH patients and 228 matched healthy controls from Shandong Province were recruited to evaluate the influence of interleukin-10 (IL-10) rs1800872, IL-12 rs3212227 and tumor necrosis factor-(TNF-alpha) rs1800629 polymorphism in osteonecrosis of the femoral head (ONFH). IL-12 rs3212227 AC genotype confer genetically susceptibility to ONFH in the Chinese Han population. PMID: 28980933
  50. Gene polymorphisms of TNF-238G/A, TNF-308G/A, IL10-1082G/A, TNFAIP3, and MC4R and comorbidity occurrence in a Romanian population with psoriasis PMID: 29696068

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed