Recombinant Human PCOLCE Protein
Beta LifeScience
SKU/CAT #: BLA-6734P
Recombinant Human PCOLCE Protein
Beta LifeScience
SKU/CAT #: BLA-6734P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q15113 |
Synonym | PCOC1_HUMAN Pcolce PCOLE 1 PCOLE1 PCPE PCPE-1 PCPE1 Procollagen C endopeptidase enhancer Procollagen C-endopeptidase enhancer Procollagen C-endopeptidase enhancer 1 Procollagen C-proteinase enhancer 1 Procollagen COOH-terminal proteinase enhancer 1 procollagen, type 1, COOH-terminal proteinase enhancer Type 1 procollagen C-proteinase enhancer protein Type I procollagen COOH-terminal proteinase enhancer |
Description | Recombinant Human PCOLCE Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVAS EGFPNLYPPNKECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAG SGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGRGFLLWYSGRA TSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNE LLVQF |
Molecular Weight | 75 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |