Recombinant Human Plasminogen (PLG) Protein (His&Myc)

Name: Recombinant Human Plasminogen (PLG) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01387P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Car-t cell therapy targets, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant proteins holiday sale

Price Save $494

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Plasminogen (PLG) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P00747
Target Symbol	PLG
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-10His&C-Myc
Target Protein Sequence	EPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYQGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Expression Range	20-810aa(R386Q)
Protein Length	Full Length of Mature Protein
Mol. Weight	92.3 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.; Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo.
Subcellular Location	Secreted. Note=Locates to the cell surface where it is proteolytically cleaved to produce the active plasmin. Interaction with HRG tethers it to the cell surface.
Protein Families	Peptidase S1 family, Plasminogen subfamily
Database References	HGNC: 9071 OMIM: 173350 KEGG: hsa:5340 STRING: 9606.ENSP00000308938 UniGene: Hs.143436
Associated Diseases	Plasminogen deficiency (PLGD)
Tissue Specificity	Present in plasma and many other extracellular fluids. It is synthesized in the liver.

Gene Functions References

Apo(a) attenuates cell-surface plasmin-mediated conversion of Glu- to Lys-plasminogen. PMID: 29990619
Urinary angiostatin and VCAM-1 are predictive of specific histological changes in concurrent lupus nephritis renal biopsies. PMID: 29076253
We did not find an association of the AgP risk variant rs4252120 with CP. However, we identified a haplotype block downstream of PLG, which showed shared association with CP and AgP. PMID: 28548211
The homozygous alleles in F12 (rs1801020) and F13 (rs5985) was identified a genetic risk profile of thromboembolism in a Family. PMID: 27976734
Our findings that plasminogen and pSTAT3 are significantly associated with LI suggest that they may represent signaling nodes or biomarkers of pathways common to the processes of postlactational involution and LI. PMID: 28752190
A rare non-conservative missense mutation was newly identified in exon 9 of the PLG gene. PMID: 29548426
Plasminogen binds to the cell surface-exposed proteins of Candida parapsilosis. PMID: 28651026
plasmin cleaves surface-bound CCL21 to release the C-terminal peptide responsible for CCL21 binding to glycosaminoglycans on the extracellular matrix and cell surfaces, thereby generating the soluble form. PMID: 27301418
Analysis of plasminogen genetic variants in multiple sclerosis patients has been reported. PMID: 27194806
Enolase of Mtb is present on its surface and binds human plasminogen with high affinity. PMID: 27569900
The mechanism for plasminogen/M protein binding uncovered here may facilitate targeting of group A Streptococcus pyogenes virulence factors for disease management PMID: 28724633
t-PA binds to Lys91 in the MBP NH2-terminal region and PLG binds to Lys122 in the MBP COOH-terminal region. This proximity promotes the activation of PLG by t-PA. PMID: 28648598
in the presence of platelet polyphosphate and the downstream substrate fibrin, alphaFXIIa is a highly efficient and favorable plasminogen activator. PMID: 27694320
Plasmin(ogen) serves as a favorable biomarker for prediction of survival in advanced high-grade serous ovarian cancer PMID: 27935848
Our findings indicate a new pathway for bradykinin formation in patients with HAE, in which FXII is cleaved and activated by plasmin. PMID: 27130860
VWF susceptibility to plasmin proteolysis at K1491-R1492 is modulated by local N-linked glycan expression within A1A2A3, and specifically inhibited by heparin binding to the A1 domain. PMID: 28279966
bone morphogenetic proteins (BMPs) and mature BMPs that have been further cleaved by serum proteases induce cell cycle entry by dedifferentiating newt muscle cells. PMID: 28350991
Plasminogen and P4HA2 are involved in vascular remodelling and angiogenesis, suggesting a high relevance of these processes for the pathogenic mechanisms underlying this type of vasculitis PMID: 28041642
Plasminogen and OxPL-PLG were lower in patients presenting with an acute MI than in those with stable CAD and also in those with atherothrombotic MI (Type 1) vs. those with non-atherothrombotic MI (Type 2). PMID: 26510751
Although carriers with PLG:p.Ala620Thr show low plasminogen activity, this is not a predisposing variant for aHUS; and individuals of dysplasminogenemia are not at significantly increased risk of aHUS. PMID: 27194432
Five novel plasminogen gene mutations have been found in Turkish patients with type I plasminogen deficiency. PMID: 26340456
A novel plasminogen gene mutation, deficiency of plasminogen antigen and activity, and anti-plasminogen IgG and IgA antibodies were identified in a patient with adult-onset ligneous conjunctivitis. PMID: 25674820
S. aureus NCTC 8325-4 adheres to immobilized plasminogen in vitro and that the adhesion may be mediated by a C-terminal fragment of the PBP3 protein.[PBP3] PMID: 27488131
we demonstrated that PLG functions as a molecular bridge between tricellulin and streptococcal surface enolase (SEN). The wild type strain efficiently translocated across the epithelial monolayer, accompanied by cleavage of transmembrane junctional proteins. PMID: 26822058
Suggest that tubulointerstitial plasmin is associated with inflammation leading to renal fibrosis, and can cause the decline in renal function seen in patients with IgA nephropathy. PMID: 25971850
Plasminogen binding and activation by different glycolytic enzymes of M. pneumoniae play a role in successful colonization of the human respiratory tract. PMID: 26667841
reduced proteolytic activity of plasmin on structures of growing thrombi, rather than on complement activation fragments, explains the association of plasminogen deficiency with aHUS. PMID: 26637181
Zinc modulates fibrinolysis by attenuating tPA-mediated plasminogen activation and plasmin-induced fibrin degradation. PMID: 25789495
These results indicate that FXIIIa activity can be modulated by fibrinolytic enzymes, and suggest that changes in fibrinolytic activity may influence cross-linking of blood proteins. PMID: 26359437
Plasmin cleavage of iC3b provides a complement regulatory pathway that is as efficient as FI/CR1 but does not require a cellular cofactor. PMID: 25556624
PLG is the third replicated shared genetic risk factor of atherosclerosis and periodontitis. PMID: 25466412
Data show that preincubation with plasminogen, wild-type group A Streptococcus (GAS) NS88.2 degraded complement C3b. PMID: 23969887
whereas the presence of plasminogen did not affect the factor I cofactor activity of C4BP, the activation of plasminogen by urokinase-type plasminogen activator to active plasmin was significantly augmented in the presence of C4BP. PMID: 26067271
These studies demonstrate that GAS virulence can be explained by disparate hPg activation by SK2a and SK2b coupled with the coinherited M-proteins of these strains PMID: 26070561
PAM activated Plasminogen Glycoform II. PMID: 26029848
High plasma fibrinogen and low plasminogen are associated with poor survival in CTEPH patients without modern therapy. PMID: 24909805
Data show that different subpopulations of platelets harbor plasminogen by diverse mechanisms PMID: 25712989
manganese transport protein C (MntC) is an extracellular matrix- and plasminogen-binding protein PMID: 25409527
This review highlights the importance of the best-characterized components of the PLG/PLA cascade in the pathogenesis of cancer focusing on the role of the cell surface-PLG receptors (PLG-R). [review] PMID: 25407528
IGF-II, TGF-beta1 and VEGF-A and its receptor in malignant tumor tissue, as well as increasedplasmin release from proenzyme and MMP-3 activationis apparently associated with the formation of pathogenic mechanism of vasculature development PMID: 25993872
Angiostatin may play a role in the pathophysiology of preeclampsia. PMID: 24205998
The results suggested that EF-Tu and Eno serve as surface receptors for B. longum NCC2705 binding to human plasminogen. PMID: 24840471
Human plasmin activity loss results from the C-terminal lysine-dependent redistribution of enzyme molecules on a fibrin surface. PMID: 25222106
Genome-wide association analyses revealed common DNA variants in PLG, LPA, and near SIGLEC14 that contribute to plasma plasminogen level variation. PMID: 25208887
ANG interacts with plasminogen activation system at the leading edges of breast cancer cell surfaces and facilitates interactions of uPAR with uPA to regulate plasmin formation and cell migration. PMID: 24457100
Reduced plasminogen binding and delayed activation render gamma'-fibrin more resistant to lysis than gammaA-fibrin. PMID: 25128532
Binding of streptokinase Lys(414) to plasminogen kringle 4 plays a role in recognition of plasminogen by streptokinase. PMID: 25138220
The surface-displayed enolase, which serves as major pneumococcal plasminogen receptor, was identified as a key factor for plasminogen-mediated bacterial attachment in infection analyses with Streptococcus pneumoniae. PMID: 23906818
The results demonstrate that Bacteroides fragilis Bfp60 surface adhesin is responsible for the recognition of laminin and plasminogen-plasmin activation. PMID: 23850366
We propose that plasminogen activation on endothelial cells acts as a natural backup for ADAMTS13 to degrade obstructive platelet-VWF complexes. PMID: 24449821

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.