Recombinant Human Protein-Lysine 6-Oxidase (LOX) Protein (MBP&His)

Name: Recombinant Human Protein-Lysine 6-Oxidase (LOX) Protein (MBP&His)
Brand: Beta LifeScience
SKU: BLC-02874P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant proteins holiday sale

Price Save $637

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Protein-Lysine 6-Oxidase (LOX) Protein (MBP&His) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P28300
Target Symbol	LOX
Synonyms	lox; LYOX; LYOX_HUMAN; Lysyl oxidase; MGC105112; Protein lysine 6 oxidase; Protein-lysine 6-oxidase
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-MBP&C-6His
Target Protein Sequence	DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Expression Range	169-417aa
Protein Length	Full Length of Mature Protein
Mol. Weight	73.0 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.
Subcellular Location	Secreted. Secreted, extracellular space.
Protein Families	Lysyl oxidase family
Database References	HGNC: 6664 OMIM: 153455 KEGG: hsa:4015 STRING: 9606.ENSP00000231004 UniGene: Hs.102267
Associated Diseases	Aortic aneurysm, familial thoracic 10 (AAT10)
Tissue Specificity	Heart, placenta, skeletal muscle, kidney, lung and pancreas.

Gene Functions References

LOX regulates EGFR cell surface retention to drive tumour progression. PMID: 28416796
The Epithelial-mesenchymal transition (EMT) marker Lox has a differential expression pattern in breast cancer, being significantly overexpressed in triple negative breast cancers. PMID: 29661738
Studies indicate that the mature enzyme plays a key role in modifying the extracellular matrix and as a result has been implicated in playing a role in the formation of cancer "niches" where tumors will develop and eventually metastasize [Review]. PMID: 29309816
Our results indicate the involvement of LOX in the initiation of fibrous capsule formation which ultimately contributes towards the progression of capsular contracture PMID: 29866167
this study has revealed that IL-1beta may contribute to the rupture of fetal membranes by attenuating collagen crosslinking through downregulation of LOX expression in amnion fibroblasts PMID: 28878297
This study focused on the relationship between lysyl oxidase (LOX), LOX-like protein 1 (LOXL1), and LOXL2 and pulmonary emphysema pathogenesis. PMID: 28965583
The aim was to examine if the serum concentrations of elastin-related proteins correlate to signs of cardiovascular diseases in patients with Diabetes mellitus type 2. PMID: 28715234
LOX role in cancer stromal cells activation and promotion of gastric cancer progression PMID: 29343955
an association of LOX gene polymorphism (G473A) on diabetes and DFU patients PMID: 28522400
LOX expression was mildly but significantly upregulated in CD34+-derived primary myelofibrosis megakaryocytes and platelets compared with controls. These megakaryocytes showed a greater tendency to adhere and spread to monomeric collagen, and this was inhibited by the LOX-specific inhibitor BAPN. PMID: 28592432
Data suggest that a missense mutation in lysyl oxidase (LOX) is associated with aortic disease. PMID: 27432961
Our findings suggest that LOX has a role in cancer cell mitosis PMID: 27296552
Our findings provide new evidence that LOX regulates SNAI2 expression and that SNAI2-mediated TIMP4 secretion plays a role in cancer progression. PMID: 27029493
UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. PMID: 28106301
LOX is a prognostic factor for poor progression free survival in patients with ER- breast cancer. LOX overexpression was positively correlated with resistance to radiation and drug therapy. PMID: 27147578
This preliminary study indicated that LOX gene polymorphisms, such as rs2303656, rs3900446, and rs763497, may play crucial roles in intracranial aneurysm formation in the Korean population. PMID: 28792146
Results show that CTGF mediates the GDF8-induced up-regulation of LOX expression and increases in LOX activity in human granulosa cells. PMID: 27392496
The LOXL1 SNPs, rs1048661 and rs3825942, are associated with PXF in the South Indian population correlating with lowered LOX activity in the aqueous humor. The increased level of total TGF-beta in the aqueous humor of PXF cases is possibly associated with LOX regulation which needs further investigation. PMID: 27116380
These findings suggest that LOX induces an age-dependent disturbance of diastolic function and aggravates Ang II-induced hypertrophy, which provides novel insights into the role of LOX in cardiac performance. PMID: 28522596
LOX, a hypoxia-responsive gene that encodes lysyl oxidase, is activated by HIF-2-alpha more than HIF-1. Two new hypoxia response elements identified in the LOX promoter mediate most HIF responsiveness. PMID: 28624448
our findings show that LOX supports colorectal cancer cell dissemination in the bone marrow PMID: 27742687
LOX G473A polymorphism apparently elevated human sensitivity to cigarette smoking carcinogens for eliciting cancers in the lung and colon only. Thus, LOX G473A polymorphism positively correlates with carcinogenesis and it may be used as an ideal intrinsic biomarker for prediction or diagnosis of carcinogenesis in humans. PMID: 27367711
increased cortisol and 11beta-HSD1 abundance and decreased LOX abundance were observed in human amnion tissue after the labor-initiated spontaneous rupture of membranes PMID: 27533889
endogenous LOX is overexpressed in clear cell renal cell carcinoma, is involved in a positive-regulative loop with HIF-1alpha, and has a major action on clear cell renal cell carcinoma progression through cellular adhesion, migration, and collagen matrix stiffness increment PMID: 27449199
colorectal carcinoma perilesional extracellular matrix has increased content of lysyl oxidase PMID: 26940881
LOX affects the epithelial-mesenchymal transition of gastric cancer cells in hypoxic conditions. PMID: 26100130
High expression of LOX is associated with nasopharyngeal carcinoma. PMID: 26882568
Here we show that orthotopic implantation of rat prostate AT-1 tumour cells increased LOX and LOXLs mRNA expressions in the tumour and in the surrounding non-malignant prostate tissue PMID: 26804196
Results show that LOX expression regulation by FoxF1 increases invasiveness of breast cancer cells. PMID: 26908052
LOX gene expression was approximately 2.5-fold higher in fetal membranes from preterm prelabor rupture of membranes (pPROM) compared to preterm and term birth. PMID: 26011922
The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites. PMID: 26893379
Cu chaperone function of Atox1 mediated through Cu transporter ATP7A is required for VEGF-induced angiogenesis via activation of Cu enzyme lysyl oxidase. PMID: 26437801
Our study demonstrated that the LOX rs1800449 genotypes (AA and GA + AA) and allele (A) appears to confer risk for susceptibility to keratoconus. PMID: 24502826
Individuals with LOX variants had fusiform enlargement of the aortic root and ascending thoracic aorta, leading to ascending aortic dissections. PMID: 26838787
two LOX variants, rs2956540 and rs10519694, may affect individual susceptibility to keratoconus PMID: 26713757
LOX expression at the mRNA and protein level, and enzymatic activity were remarkably upregulated in the hypoxic A549 cells, compared with normoxic A549 cells. PMID: 26515140
Aortic tissue from Marfan syndrome patients and display enhanced expression of the members of the LOX family, LOX and LOX-like 1. PMID: 25988230
Evidence for association was found for both of the tested loci.It was strongest for rs3735520:G>A near HGF with A allele being a risk factor and rs2956540:G>C within LOX with C allele having a protective effect PMID: 25735481
Using principal component analysis (PCA), the authors identified a LOX/hypoxia signature associated with poor patient survival in resectable pancreatic ductal adenocarcinoma patients. PMID: 26077591
Serum sLOX-1 levels were independently correlated with the presence and severity of OSA. PMID: 25825846
hypoxic stress of obstructive sleep apnea may increase circulating lysyl oxidase (LOX) levels; LOX may serve as a biomarker of liver fibrosis in patients with severe obesity and nonalcoholic fatty liver disease PMID: 26085300
these results corroborate the role of LOX in the migration, invasion and angiogenesis of astrocytomas. Furthermore, LOX expression is influenced by IDH1 mutational status. PMID: 25790191
LOX gene expression is a predictive factor in hepatocellular liver cancer prognosis and mortality. PMID: 26048020
High lysyl oxidase expression level in amnion is associated with higher birth weight of Tibetan newborns. PMID: 25501874
High LOX expression was associated with a poor disease-free and metastasis-free survival in ER negative but not ER positive breast cancer patients. PMID: 25141126
Study demonstrated that reactive oxygen species promote the migration and metastatic growth of ovarian cancer cells via upregulation of HIF-1a and LOX and E-cadherin repression. PMID: 25174950
LOX activity is required in the control of collagen fibril architecture. PMID: 25979340
Attenuation of lysyl oxidase and collagen gene expression in keratoconus patient corneal epithelium corresponds to disease severity. PMID: 25593510
LOX may play a role in the metastasis of non-small cell lung cancer by promoting MMP2/MMP9 expression. LOX expression is an independent prognostic factor for survival in NSCLC. PMID: 25337249
LOX is a novel regulator of NFATc1-driven osteoclastogenesis, independent of RANK ligand, which disrupts normal bone homeostasis leading to the formation of focal pre-metastatic lesions PMID: 26017313

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.