Recombinant Human PSENEN Protein (N-10xHis)
Beta LifeScience
SKU/CAT #: BLC-11446P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human PSENEN Protein (N-10xHis)
Beta LifeScience
SKU/CAT #: BLC-11446P
Regular price
$94900
$949.00
Sale price$29900
$299.00Save $650
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9NZ42 |
Target Symbol | PSENEN |
Species | Human |
Expression System | in vitro E.coli expression system |
Tag | N-terminal 10xHis-tagged |
Target Protein Sequence | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP |
Expression Range | 1-101aa |
Protein Length | Full Length |
Mol. Weight | 14.8 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from Tris/PBS-based buffer, 6% Trehalose |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Function | Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels (Probable). PSENEN modulates both endoproteolysis of presenilin and gamma-secretase activity. |
Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. |
Protein Families | PEN-2 family |
Database References |
HGNC: 30100 OMIM: 607632 KEGG: hsa:55851 STRING: 9606.ENSP00000222266 UniGene: Hs.534465 |
Tissue Specificity | Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. |