Recombinant Human Repulsive Guidance Molecule A (RGMA) Protein (MBP&His)
Beta LifeScience
SKU/CAT #: BLC-02072P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Repulsive Guidance Molecule A (RGMA) Protein (MBP&His)
Beta LifeScience
SKU/CAT #: BLC-02072P
Regular price
$1,40400
$1,404.00
Sale price$29900
$299.00Save $1,105
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Repulsive Guidance Molecule A (RGMA) Protein (MBP&His) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q96B86 |
Target Symbol | RGMA |
Synonyms | Repulsive guidance molecule A; RGM; RGM domain family member A; RGMA; RGMA_HUMAN |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-MBP&C-6His |
Target Protein Sequence | PHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGRA |
Expression Range | 169-424aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 72.5 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. Binding to its receptor NEO1/neogenin induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. Furthermore, RGMA binding to NEO1/neogenin leads to HRAS inactivation by influencing HRAS-PTK2/FAK1-AKT1 pathway. It also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Protein Families | Repulsive guidance molecule (RGM) family |
Database References |
Gene Functions References
- Dysregulation of RGMa plays an important role in the pathology of Parkinson's disease. PMID: 28842419
- Thus, we conclude that RGMa inhibits angiogenesis in vitro and in vivo suggesting that its manipulation would be an efficient therapeutic strategy for pro-angiogenic conditions. PMID: 26721439
- RGMa expression and promoter methylation status are closely related to colorectal cancer genesis and progression. PMID: 22367090
- identification of neogenin-binding site on the repulsive guidance molecule A PMID: 22396795
- The expression of RGMA, RGMB and RGMC was evident in most examined prostate cancer cell lines, and also in the prostate cancer tissues PMID: 22076499
- Reduced expression of RGMA in breast cancer was associated with breast cancer. PMID: 21617229
- The full-length signal peptides of RGMa is functional and furthermore that the C-domains are sufficient and essential for ER targeting, whereas the N-domains are dispensable. Thus, the N-domains are available for additional functions. PMID: 21183991
- RGM-A is a unique endogenous inhibitor of leukocyte chemotaxis that limits inflammatory leukocyte traffic PMID: 21467223
- Following central nervous system injury, RGM, a novel, potent axonal growth inhibitor, is present in axonal growth impediments: the mature myelin, choroid plexus, and components of the developing scar. PMID: 16216939
- RGMa facilitates the use of ActRIIA by endogenous BMP2 and BMP4 ligands that otherwise prefer signaling via BMPRII and increased utilization of ActRIIA leads to generation of an enhanced BMP signal PMID: 17472960
- detected a homozygous deletion of chromosomal region 15q26.2 in the cell line HDLM2 encompasing RGMA and CHD2 PMID: 17606441
- this study, we show that Unc5B, a member of the netrin receptor family, interacts with neogenin as a coreceptor for RGMa. PMID: 19273616
- Frequent inactivation of axon guidance molecule RGMA in human colon cancer through genetic and epigenetic mechanisms. PMID: 19303019