Recombinant Human Ribonuclease 3/ECP Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7800P
Recombinant Human Ribonuclease 3/ECP Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7800P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P12724 |
Synonym | Cytotoxic ribonuclease ECP ECP_HUMAN Eosinophil cationic protein OTTHUMP00000164017 Ribonuclease 3 Ribonuclease, RNase A family, 3 RNase 3 RNASE3 RNS3 |
Description | Recombinant Human Ribonuclease 3/ECP Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMRPPQFTRAQWFA IQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRC PHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACD NRDPRDSPRYPVVPVHLDTTI |
Molecular Weight | 20 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |