Recombinant Human Secreted And Transmembrane Protein 1 (SECTM1) Protein (hFc), Active

Name: Recombinant Human Secreted And Transmembrane Protein 1 (SECTM1) Protein (hFc), Active
Brand: Beta LifeScience
SKU: BLC-05851P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind human SECTM1, the EC 50 is 1.811-3.372 ng/ml. Biological Activity Assay

Activity Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay. Biological Activity Assay

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - active proteins, Recombinant proteins fall special offers - transmembrane proteins, Recombinant proteins holiday sale

Price Save $58

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Secreted And Transmembrane Protein 1 (SECTM1) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	1. Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind human SECTM1, the EC 50 is 1.811-3.372 ng/ml. 2. Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay.
Uniprotkb	Q8WVN6
Target Symbol	SECTM1
Synonyms	(Protein K-12)(K12)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Expression Range	29-145aa
Protein Length	Partial
Mol. Weight	41.6 kDa
Research Area	Cancer
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May be involved in thymocyte signaling.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Secreted.
Protein Families	SECTM family
Database References	HGNC: 10707 OMIM: 602602 KEGG: hsa:6398 STRING: 9606.ENSP00000269389 UniGene: Hs.558009
Tissue Specificity	Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic

Gene Functions References

CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues PMID: 24157461
SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells. PMID: 24211252
level of SECTM1 expression is likely to be a key factor in innate immune responses and in the immune tolerance of cancerous cells PMID: 21749909

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.