Recombinant Human Solute Carrier Family 22 Member 1 (SLC22A1) Protein (His-SUMO)

Name: Recombinant Human Solute Carrier Family 22 Member 1 (SLC22A1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-06401P
Price: 349.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - transmembrane proteins, Recombinant proteins holiday sale

Price Save $200

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Solute Carrier Family 22 Member 1 (SLC22A1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O15245
Target Symbol	SLC22A1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	GFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
Expression Range	43-149aa
Protein Length	Partial
Mol. Weight	24.5 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase.
Subcellular Location	Basolateral cell membrane; Multi-pass membrane protein.
Protein Families	Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Database References	HGNC: 10963 OMIM: 602607 KEGG: hsa:6580 STRING: 9606.ENSP00000355930 UniGene: Hs.117367
Tissue Specificity	Widely expressed with high level in liver. Isoform 1 and isoform 2 are expressed in liver. Isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in glial cell lines.

Gene Functions References

Two SNPs and two insertions/deletions were detected in exon 7 of SLC22A1. For exon 7, 1222AA carriers together with the presence of both the 8-bp insertion and 3-bp deletion, and M420del alleles showed higher possibility of developing resistance towards Imatinib mesylate (IM)treatment. Our results warrant the need of genotyping this SNP in terms of modulating IM treatment in chronic myeloid leukaemia patients. PMID: 30262695
data indicate that OCT1 may contribute to uptake metformin and regulate pancreatic stellate cells (PSCs) activity. OCT1 is a target of metformin in regulating PSCs activity. PMID: 29949790
inhibitory potency for morphine uptake was affected by the OCT1*2 allele. OCT2 showed only a limited uptake of ranitidine that was not significantly affected by the Ala270Ser polymorphism PMID: 29236753
Results indicated that OCT1 rs628031 and ABCG2 rs2231142 were associated with plasma lamotrigine concentrations in Han Chinese patients with epilepsy. PMID: 27610747
The additional role of SLC22A1/OCT1 genetics in M1 exposure in neonates. PMID: 27082504
The pregnane X receptor down-regulates organic cation transporter 1 (SLC22A1) in human hepatocytes by competing for ("squelching") SRC-1 coactivator. PMID: 26920453
Variants of SLC22A1 gene are associated with serum acylcarnitines and metabolic diseases. PMID: 28942964
summarize current understanding of human OCT1 transporter hepatic gene regulation and propose potential post-transcriptional regulation by predicted miRNAs. PMID: 27278216
The response to 6 months of metformin treatment (HbA1c , homeostasis model assessment for insulin resistance, fasting insulin, and glucose changes) did not differ between SLC22A1 wild-type subjects and carriers of presumably low-activity SLC22A1 alleles PMID: 27407018
we assessed the role of miR-21 in mediating renal cell carcinoma chemoresistance and further showed that miR-21 silencing significantly (1) increased chemosensitivity of paclitaxel, 5-fluorouracil, oxaliplatin, and dovitinib; (2) decreased expression of multi-drug resistance genes; and (4) increased SLC22A1/OCT1, SLC22A2/OCT2, and SLC31A1/CTR1 platinum influx transporter expression PMID: 28714373
This condensed chromatin structure is associated with binding of DNMT3B and decreased occupancy of OCT1 transcription factor at MAML2 enhancer, suggesting a role of DNMT3B in increasing methylation of MAML2 after stilbenoid treatment. PMID: 27207652
genetic association studies in population of patients newly diagnosed type 2 diabetes in Bosnia and Herzegovina: Data suggest that genetic variations in OCT1 [R61C (rs12208357); M420del (rs72552763)] are associated with severe intolerance/gastrointestinal side effects due to metformin use in patients with type 2 diabetes. PMID: 26605869
This study indicates a promising role for intratumoral OCT1 mRNA expression as a prognostic biomarker in therapeutic algorithms in HCC PMID: 26872727
Homozygous carriers of the polymorphic OCT1 C-allele had no metformin-related toxicity as compared with 41.9% for any metformin-related toxicity in carriers of at least one wild-type A-allele PMID: 25753371
hOCT1 is a suitable bendamustine transporter, thereby contributing to its cytotoxic effect depending upon the hOCT1 genetic variants expressed PMID: 25582574
A positive association was observed between the expression of the ABCB1 and ABCG2 transporter genes (r=0.407, P<0.05) while no association was observed between the expression of either of the ABC transporter genes with the OCT1 gene PMID: 26354214
Data indicate no association was found between genotypes of drug transporters ABCB1, ABCG2, OCT1 genetic polymorphisms and the occurrence of thrombocytopenia. PMID: 26546461
Findings suggest specific involvement of each organic cation transporters (OCT1-3) in drug transportation. PMID: 25883089
Data show that organic cation transporter (hOCT1) exon 2 GG homozygotes had higher imatinib (IM) levels than CG/CC genotypes, but the difference was not statistically significant. PMID: 24524306
Our data suggest that besides bodyweight, OCT1 and ABCC3 genotypes play a significant role in the pharmacokinetics of intravenous morphine and its metabolites in children PMID: 25155932
Nucleoside transporters and human OCT1 determine the cellular handling of DNA-methyltransferase inhibitors PMID: 24780098
The hOCT1 expression level can be an important predictor in CML patients treated with IM. PMID: 25358338
OCT1 plays a significant role in hepatic elimination of serotonin at the transporter level. PMID: 24688079
Clopidogrel/clopidogrel carboxylate are strong inhibitors and high affinity substrates of OCT1. PMID: 24530383
OCT1 genetic variants are associated with long term outcomes in imatinib treated chronic myeloid leukemia patients. PMID: 24215657
The present study is the first report on the association of OCT-1 genetic polymorphisms with the overall development and jaundice-type progression of primary biliary cirrhosis. PMID: 23612856
Cellular uptake of imatinib is independent of OCT1, and therefore OCT1 is apparently not a valid biomarker for imatinib resistance. PMID: 24352644
OCT variants ( OCT1, OCT2 and ATM) were significantly associated with elevated baseline and glucose-induced C-peptide levels in polycystic ovary syndrome PMID: 24533710
Rhodamine 123 is a high-affinity substrate for both hOCT1 and hOCT2. PMID: 22913740
Decreased SLC22A1 mRNA expression is associated with low imatinib response in chronic myeloid leukemia. PMID: 24469953
Glucocorticoid receptor-induced expression of HNF4alpha may contribute to indirect OCT1 gene up-regulation by dexamethasone in primary human hepatocytes. PMID: 24399729
OCT1 genotypes play a significant role in intravenous morphine pharmacokinetics PMID: 23859569
Hepatocellular carcinoma and cholangiocarcinoma is accompanied by OCT1(SCC22A1) down-regulation together with the appearance of genetic variants that may affect the ability of these tumors to take up and respond to sorafenib (chemoresistance). PMID: 23532667
The SNP 408V>M (g.1222G>A) was present in 65% of CML patients & was associated in all cases with an 8-base-pair insertion (8(+) allele) at the 3' end of exon 7. Patients lacking 8(+) and 3(-) showed the best outcomes. PMID: 24117365
The expression of Oct1 mRNA is mediated by loss of T cells, but not B cells in immune-mediated liver disease. PMID: 23929842
The intron 1 evolutionary conserved region of OCT1 increases Oct1 promoter activity. PMID: 23922447
The accumulation of lamivudine in CD4 cells of HIV-infected patients is related to the expression of OCT1 and OCT2. PMID: 22875535
hOCT1 in the sinusoidal membrane of hepatocytes, and potentially the basolateral membrane of proximal tubule cells, is likely to play a role in the disposition of fluoroquinolone antimicrobial agents. PMID: 23545524
demonstrated that PER2 served as a transcriptional corepressor, which recruited polycomb proteins EZH2 and SUZ12 as well as HDAC2 to octamer transcription factor 1 (OCT1) (POU2F1) binding sites of the TWIST1 and SLUG promoters PMID: 23836662
The downregulation of OCT1 is associated with tumor progression and worse overall patient survival rates. PMID: 23440379
Expression levels of OCT1 were not changed in relation to the -1756 genotypes. PMID: 22498645
SLC22A1-ABCB1 haplotypes may influence IM pharmacokinetics in Asian CML patients. PMID: 23272163
This mini-review discusses structural requirements for both OCT1 and OCT2 versus the blood-brain barrier choline transporter (BBBCHT) are discussed and compared. PMID: 22483271
the data indicate that Oct1 regulates normal and cancer stem cell function PMID: 23144633
Seven polymorphisms in OCT1, OCT2, and MATE1 genes were compared between 53 type 2 diabetes patients with side effects of metformin and 193 metformin users without symptoms of metformin intolerance. PMID: 22735389
The hOCT1 SNPs M420del and M408V alter imatinib uptake and M420del modifies clinical outcome in imatinib-treated chronic myeloid leukemia. PMID: 23223357
High-dose imatinib leads to superior molecular responses in patients with low OCT-1 activity. PMID: 22207690
A substrate binding hinge domain is critical for transport-related structural changes of organic cation transporter 1. PMID: 22810231
data suggest a model for the sequence of binding events involved in synergistic gene regulation by Sox2 and Oct1 PMID: 22718759
evaluated the pretherapeutic mRNA expression of the hOCT1 (human organic cation transporter 1) gene in patients with chronic-phase (CP) chronic myeloid leukemia (CML) who varied in terms of their response to imatinib PMID: 22508387

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.