Recombinant Human Solute Carrier Organic Anion Transporter Family Member 2B1 (SLCO2B1) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-04953P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Solute Carrier Organic Anion Transporter Family Member 2B1 (SLCO2B1) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-04953P
Regular price $692.00 Sale price $299.00Save $393
/
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Solute Carrier Organic Anion Transporter Family Member 2B1 (SLCO2B1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb O94956
Target Symbol SLCO2B1
Synonyms SLCO2B1; KIAA0880; OATP2B1; OATPB; SLC21A9; Solute carrier organic anion transporter family member 2B1; Organic anion transporter B; OATP-B; Organic anion transporter polypeptide-related protein 2; OATP-RP2; OATPRP2; Solute carrier family 21 member 9
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF
Expression Range 461-564aa
Protein Length Partial
Mol. Weight 18.4 kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Mediates the Na(+)-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families Organo anion transporter (TC 2.A.60) family
Database References
Tissue Specificity Isoform 1 has it's highest expression in brain, it is the major form expressed in duodenum, kidney, placenta, and skeletal muscle. Isoform 3 predominates in liver.

Gene Functions References

  1. PDZK1 directly interacts with OATP2B1 resulting in a change of the amount of transporter in the membrane, and thereby in an increased transport function. PMID: 29752999
  2. Report inhibition of organic anion-transporting polypeptide 2B1 by crude drug extracts used in Japanese traditional Kampo medicines. PMID: 29248449
  3. Significant interaction between SLCO2B1 genotypes and treatment over time for parasitemia clearance rate on day 2 were observed. PMID: 28975866
  4. It shows high expression of OATP2B1 mRNA in human pancreatic islets. PMID: 28815335
  5. genetic association studies in population in South Korea: Data suggest that an SNP in SLCO2B1 (c.935G>A, rs12422149) is associated with lipid-lowering response to rosuvastatin (an HMG-CoA reductase inhibitor) in subjects with hypercholesterolemia. PMID: 28627804
  6. The OATP2B1 was primarily found in beta cells, suggesting a distinct expression pattern for OATP1B3 and OATP2B1 in islets. PMID: 28493059
  7. results indicate that insulin acts on the small intestine to increase OATP2B1-mediated absorption PMID: 28318878
  8. Data show that prostaglandin E3 (PGE3) uptake by prostaglandin transporter OATP2A1-expressing HEK293 cells (HEK/2A1) was the highest and followed by SLCO2B1 (HEK/1B1). PMID: 26692285
  9. OATP2B1 contributes to the uptake of SN-38 by intestinal tissues, triggering gastrointestinal toxicity. PMID: 26526067
  10. The association of SNP rs1077858 with OS may be a result of differential SLCO2B1 expression and the consequent increased uptake of DHEAS and subsequent resistance to ADT, which, in turn, may contribute to decreased OS. PMID: 26668348
  11. Suggest that OATP2B1 is involved in cell proliferation by increasing the amount of estrogen in ER1-positive breast cancer cells. PMID: 25857231
  12. OATP2B1 as a determinant of pharmacokinetics in the coronary artery. PMID: 26091578
  13. These results suggest that OATP2B1 plays an important role in the stereoselective pharmacokinetics of fexofenadine and that one-time apple juice ingestion probably inhibits intestinal OATP2B1-mediated transport of both enantiomers PMID: 24903351
  14. The genotypes of the two other SLCOs,SLCO1B3 and SLCO2B1, did not show any association with bladder cancer susceptibility PMID: 24762081
  15. SLCO2B1 rs12422149 variants could provide prognostic value for prostate cancer patients treated with androgen deprivation therapy (ADT) and influence ethnic differences in response to ADT. PMID: 23896625
  16. SLCO2B1 polymorphisms do not affect the pharmacokinetics of montelukast and SLCO2B1 polymorphisms appear to be a minor determinant of inter-individual variability of montelukast. PMID: 23970434
  17. the major OATP2B1 protein form in liver is transport competent and its hepatic expression is regulated by HNF4alpha. PMID: 23531488
  18. SLCO2B1 c.935G>A single nucleotide polymorphism has no effect on the pharmacokinetics of montelukast and aliskiren. PMID: 23151832
  19. Report flavonoid components in grapefruit, orange, and apple juices responsible for OATP2B1-mediated drug interactions. PMID: 23132664
  20. in end-stage renal failure patients, some uremic toxins are related to the downregulation of intestinal MRP2 and hepatic OATP1B1 and/or OATP2B1 PMID: 23190519
  21. The selective hepatic uptake of scutellarin mediated by OATP2B1 is likely a key determinant of its unique pharmacokinetic characteristics. PMID: 22822035
  22. Data suggest the OATP2B1 has multiple binding sites for endogenous steroids, dietary flavones, and drugs; the binding sites vary in affinity for ligands. PMID: 22201122
  23. OATP2B1 represents a low-affinity transport route for antifolates at low pH. In contrast, the high affinity of this transporter for sulfobromophthalein seems to be intrinsic to its binding site and independent of pH. PMID: 22021325
  24. investigation of vectorial transport across enterocytes: Data from Caco-2 cells, models of intestinal absorption, suggest that OATP2B1 mediates apical fexofenadine/zwitterion uptake. Recombinant OATP2B1 mediates fexofenadine uptake in MDCKII cells. PMID: 21780830
  25. The biologic function of a SLCO2B1 coding SNP in transporting androgen was examined. 3 SNPs in SLCO2B1 were associated with time to progression in androgen-deprived prostatic cancer patients. PMID: 21606417
  26. SLCO2B1 is a major transporter for montelukast and pharmacokinetics were affected by SLCO2B1 genotype and not fruit juice. PMID: 20974993
  27. Six SLCO genes were highly expressed in castration resistane prostate cancer metastases versus untreated prostate cancer, including SLCO1B3 and SLCO2B. PMID: 21266523
  28. tissue-specific localization of OATP2B1, OATP3A1 and OATP5A1 has been analyzed in normal mammary tissue and corresponding breast cancer tissues. PMID: 21278488
  29. Is present in high frequencies in the finnish population PMID: 20560925
  30. OATP2B1/SLCO2B1 function is modulated by protein kinase C-mediated internalization PMID: 20159975
  31. uptake of steroid sulfates by isolated trophoblasts is mediated by OATP-B and OAT-4 suggesting a physiological role of both carrier proteins in placental uptake of fetal-derived steroid sulfates. PMID: 12409283
  32. The trafficking and function of OATP2B1 is vulnerable to changes in the cysteine residues of extracellular loop IX-X. PMID: 16754786
  33. The results indicate functional modification of OATP2B1-mediated estrone-3-sulfate and dehydroepiandrosterone-sulfate as well as pregnenolone sulfate transport through steroid hormones such as progesterone. PMID: 16908597
  34. Functional differences in steroid uptake of SLC22A9 and SLC02B1 in human placenta are reported. PMID: 18501590
  35. OATP2B1 is an uptake transporter expressed in platelets and is involved in statin-mediated alteration of platelet aggregation PMID: 19237515
  36. Results describe the transcription of the OATP2B1 gene (SLCO2B1) in 14 different human tissues by means of 5'-RACE analysis. PMID: 19383542
  37. OATP2B1 -282G > A is a major factor affecting expression, suggesting a contribution to inter-individual differences in the expression level of OATP2B1 in human liver PMID: 19620935

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed