Recombinant Human Solute Carrier Organic Anion Transporter Family Member 2B1 (SLCO2B1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04953P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Solute Carrier Organic Anion Transporter Family Member 2B1 (SLCO2B1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04953P
Regular price
$69200
$692.00
Sale price$29900
$299.00Save $393
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Solute Carrier Organic Anion Transporter Family Member 2B1 (SLCO2B1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O94956 |
Target Symbol | SLCO2B1 |
Synonyms | SLCO2B1; KIAA0880; OATP2B1; OATPB; SLC21A9; Solute carrier organic anion transporter family member 2B1; Organic anion transporter B; OATP-B; Organic anion transporter polypeptide-related protein 2; OATP-RP2; OATPRP2; Solute carrier family 21 member 9 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF |
Expression Range | 461-564aa |
Protein Length | Partial |
Mol. Weight | 18.4 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Mediates the Na(+)-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | Organo anion transporter (TC 2.A.60) family |
Database References | |
Tissue Specificity | Isoform 1 has it's highest expression in brain, it is the major form expressed in duodenum, kidney, placenta, and skeletal muscle. Isoform 3 predominates in liver. |
Gene Functions References
- PDZK1 directly interacts with OATP2B1 resulting in a change of the amount of transporter in the membrane, and thereby in an increased transport function. PMID: 29752999
- Report inhibition of organic anion-transporting polypeptide 2B1 by crude drug extracts used in Japanese traditional Kampo medicines. PMID: 29248449
- Significant interaction between SLCO2B1 genotypes and treatment over time for parasitemia clearance rate on day 2 were observed. PMID: 28975866
- It shows high expression of OATP2B1 mRNA in human pancreatic islets. PMID: 28815335
- genetic association studies in population in South Korea: Data suggest that an SNP in SLCO2B1 (c.935G>A, rs12422149) is associated with lipid-lowering response to rosuvastatin (an HMG-CoA reductase inhibitor) in subjects with hypercholesterolemia. PMID: 28627804
- The OATP2B1 was primarily found in beta cells, suggesting a distinct expression pattern for OATP1B3 and OATP2B1 in islets. PMID: 28493059
- results indicate that insulin acts on the small intestine to increase OATP2B1-mediated absorption PMID: 28318878
- Data show that prostaglandin E3 (PGE3) uptake by prostaglandin transporter OATP2A1-expressing HEK293 cells (HEK/2A1) was the highest and followed by SLCO2B1 (HEK/1B1). PMID: 26692285
- OATP2B1 contributes to the uptake of SN-38 by intestinal tissues, triggering gastrointestinal toxicity. PMID: 26526067
- The association of SNP rs1077858 with OS may be a result of differential SLCO2B1 expression and the consequent increased uptake of DHEAS and subsequent resistance to ADT, which, in turn, may contribute to decreased OS. PMID: 26668348
- Suggest that OATP2B1 is involved in cell proliferation by increasing the amount of estrogen in ER1-positive breast cancer cells. PMID: 25857231
- OATP2B1 as a determinant of pharmacokinetics in the coronary artery. PMID: 26091578
- These results suggest that OATP2B1 plays an important role in the stereoselective pharmacokinetics of fexofenadine and that one-time apple juice ingestion probably inhibits intestinal OATP2B1-mediated transport of both enantiomers PMID: 24903351
- The genotypes of the two other SLCOs,SLCO1B3 and SLCO2B1, did not show any association with bladder cancer susceptibility PMID: 24762081
- SLCO2B1 rs12422149 variants could provide prognostic value for prostate cancer patients treated with androgen deprivation therapy (ADT) and influence ethnic differences in response to ADT. PMID: 23896625
- SLCO2B1 polymorphisms do not affect the pharmacokinetics of montelukast and SLCO2B1 polymorphisms appear to be a minor determinant of inter-individual variability of montelukast. PMID: 23970434
- the major OATP2B1 protein form in liver is transport competent and its hepatic expression is regulated by HNF4alpha. PMID: 23531488
- SLCO2B1 c.935G>A single nucleotide polymorphism has no effect on the pharmacokinetics of montelukast and aliskiren. PMID: 23151832
- Report flavonoid components in grapefruit, orange, and apple juices responsible for OATP2B1-mediated drug interactions. PMID: 23132664
- in end-stage renal failure patients, some uremic toxins are related to the downregulation of intestinal MRP2 and hepatic OATP1B1 and/or OATP2B1 PMID: 23190519
- The selective hepatic uptake of scutellarin mediated by OATP2B1 is likely a key determinant of its unique pharmacokinetic characteristics. PMID: 22822035
- Data suggest the OATP2B1 has multiple binding sites for endogenous steroids, dietary flavones, and drugs; the binding sites vary in affinity for ligands. PMID: 22201122
- OATP2B1 represents a low-affinity transport route for antifolates at low pH. In contrast, the high affinity of this transporter for sulfobromophthalein seems to be intrinsic to its binding site and independent of pH. PMID: 22021325
- investigation of vectorial transport across enterocytes: Data from Caco-2 cells, models of intestinal absorption, suggest that OATP2B1 mediates apical fexofenadine/zwitterion uptake. Recombinant OATP2B1 mediates fexofenadine uptake in MDCKII cells. PMID: 21780830
- The biologic function of a SLCO2B1 coding SNP in transporting androgen was examined. 3 SNPs in SLCO2B1 were associated with time to progression in androgen-deprived prostatic cancer patients. PMID: 21606417
- SLCO2B1 is a major transporter for montelukast and pharmacokinetics were affected by SLCO2B1 genotype and not fruit juice. PMID: 20974993
- Six SLCO genes were highly expressed in castration resistane prostate cancer metastases versus untreated prostate cancer, including SLCO1B3 and SLCO2B. PMID: 21266523
- tissue-specific localization of OATP2B1, OATP3A1 and OATP5A1 has been analyzed in normal mammary tissue and corresponding breast cancer tissues. PMID: 21278488
- Is present in high frequencies in the finnish population PMID: 20560925
- OATP2B1/SLCO2B1 function is modulated by protein kinase C-mediated internalization PMID: 20159975
- uptake of steroid sulfates by isolated trophoblasts is mediated by OATP-B and OAT-4 suggesting a physiological role of both carrier proteins in placental uptake of fetal-derived steroid sulfates. PMID: 12409283
- The trafficking and function of OATP2B1 is vulnerable to changes in the cysteine residues of extracellular loop IX-X. PMID: 16754786
- The results indicate functional modification of OATP2B1-mediated estrone-3-sulfate and dehydroepiandrosterone-sulfate as well as pregnenolone sulfate transport through steroid hormones such as progesterone. PMID: 16908597
- Functional differences in steroid uptake of SLC22A9 and SLC02B1 in human placenta are reported. PMID: 18501590
- OATP2B1 is an uptake transporter expressed in platelets and is involved in statin-mediated alteration of platelet aggregation PMID: 19237515
- Results describe the transcription of the OATP2B1 gene (SLCO2B1) in 14 different human tissues by means of 5'-RACE analysis. PMID: 19383542
- OATP2B1 -282G > A is a major factor affecting expression, suggesting a contribution to inter-individual differences in the expression level of OATP2B1 in human liver PMID: 19620935