Recombinant Human Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07677P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07677P
Regular price
$1,40400
$1,404.00
Sale price$34900
$349.00Save $1,055
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Spectrin Alpha Chain, Erythrocytic 1 (SPTA1) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P02549 |
Target Symbol | SPTA1 |
Synonyms | Erythroid alpha-spectrin |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His |
Target Protein Sequence | YHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALATSRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQ |
Expression Range | 53-474aa |
Protein Length | Partial |
Mol. Weight | 51.7 kDa |
Research Area | Cell |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. |
Subcellular Location | Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. |
Protein Families | Spectrin family |
Database References | |
Associated Diseases | Elliptocytosis 2 (EL2); Hereditary pyropoikilocytosis (HPP); Spherocytosis 3 (SPH3) |
Gene Functions References
- a novel HE case with a His54Pro mutation in the SPTA1 gene was reported. The results suggested that the His54Pro mutation influenced the role of erythrocyte membrane proteins without reducing its level of expression. PMID: 29484404
- A novel SPTA1 mutation (H54P) was identified in a case of hereditary elliptocytosis. PMID: 28694211
- The authors show that SUB1-mediated processing of MSP1 is important for parasite viability, the processing modifies the secondary structure of MSP1 and activates its capacity to bind spectrin. PMID: 26468747
- The authors demonstrate that the initial vacuolar membrane around internalized Babesia divergens is formed from protein and lipid components of the red blood cells plasma membrane, including band 3, glycophorin A and spectrin. PMID: 25628009
- a new function for spectrins in the stability of invadosomes and the coupling between actin regulation and ECM degradation PMID: 25830635
- Case Report: severe hemolytic jaundice and a phenotype of hereditary spherocytosis due alpha-spectrin mutations. PMID: 25277063
- In this review, we summarize the state of knowledge about interactions between spectrin and membrane lipids PMID: 24569979
- A novel exon 2 alpha spectrin mutation is identified in two families of European ancestry with hereditary pyropoikilocytosis. PMID: 24077844
- The heterozygous c.121C>T mutation of SPTA1 gene induces an amino acid change p.Arg41Trp in the alpha1 domain of the alpha-spectrin protein. PMID: 24003435
- Data show that transcription cofactor TAF3 is required for transcription of the alpha spectrin SPTA1 gene. PMID: 23935956
- The common hereditary elliptocytosis-associated alpha-spectrin leucine260proline mutation perturbs erythrocyte membranes by stabilizing spectrin in the closed dimer conformation. PMID: 23974198
- The unusually slow, two-state kinetics of spectrin assembly in solution, was investigated. PMID: 23200054
- In this review, we summarize recent findings concerning structure and function of spectrin together with its possible role in pathology. PMID: 23373410
- These data further suggest that residues 44 and 53, which are key players in the nucleation-condensation mechanism of folding, are also important triggers of the aggregation process. PMID: 22727745
- analysis of glycosylation of erythrocyte spectrin and its modification in visceral leishmaniasis PMID: 22164239
- Further studies involving siRNA-mediated knockdowns of spectrin, adducin, or p4.1 revealed that those proteins are needed for efficient docking of enterohaemorrhagic Escherichia coli to host cells. PMID: 22197999
- Results suggest that it is possible for cellular proteins to differentially associate with the C-termini of different beta-spectrin isoforms to regulate alpha- and beta-spectrin association to form functional spectrin tetramers. PMID: 21412925
- lipid rafts are associated with the spectrin skeleton in human erythrocytes PMID: 20807499
- The data show that the alpha-spectrin EF domain greatly amplifies the function of the beta-spectrin actin-binding domain in forming the spectrin-actin-4.1R complex. PMID: 20585040
- The functional roles of residues 21-43 and 55-59 in the alpha-spectrin N-terminal region in forming tetramers were determined;mutations may also introduce abnormalities to erythrocytes. PMID: 19747366
- identification and characterization of the gene promoter; requires GATA-1- and NF-E2-binding proteins to direct high level expression in erythroid cells in vitro. PMID: 12196550
- Quantitative analysis of erythrocyte membrane proteins revealed increase in alpha-spectrin from patients with homozygous and heterozygous forms of beta-thalassemia. PMID: 15310273
- a region 3' of the alpha-spectrin core promoter contains a GATA-1-dependent positive regulatory element that is required in its proper genomic orientation PMID: 15456760
- analysis of erythroid alpha and beta spectrin chaperone activity and prodan binding PMID: 15492010
- Ubiquitination of alpha-spectrin does not regulate heterodimer formation. PMID: 15795915
- splicing mutation in hereditary pyropoikilocytosis kindred PMID: 16150946
- We found that cysteine 2071 & cysteine 2100 are critical for alpha-spectrin (2005-2415) E2/E3 activity; also demonstrated that both Cys2071 & Cys2100 are capable of transferring ubiquitin from an E1 enzyme to target sites within alpha-spectrin (2005-2415) PMID: 16171554
- the interaction of the alphaII-spectrin SH3 domain with EVL PMID: 16336193
- These results suggest a role for spectrin in providing a dynamic and reversible signaling platform to the specific domains of the plasma membrane in response to stimulation of GPCR. PMID: 16551696
- Results provide evidence that protein degradation of alphaII-spectrin is a reliable marker of severe traumatic brain injury (TBI) in humans and that both necrotic and apoptotic cell death mechanisms are activated in humans following a severe TBI. PMID: 16841024
- REVIEW: Culture studies of Plasmodium falciparum in elliptocytes bearing such elliptocytogenic alleles of spectrin showed that these alleles are supplementary genetic factors of malaria resistance PMID: 17414207
- The absence of particular spectrin isoforms may correlate with transformation or aggressive biologic behavior for some lymphoma subtypes. PMID: 17885671
- analysis of the conformational change of erythroid alpha-spectrin at the tetramerization site upon binding beta-spectrin PMID: 17905835
- This model supports the hypothesis that initial docking of the correct alpha and beta repeats from among many very similar repeats in both subunits is driven primarily by long range electrostatic interactions. PMID: 17977835
- All alpha0 HE/HPP mutations studied here appear to exert their destabilizing effects through molecular recognition rather than structural mechanisms. PMID: 18218854
- Erythrocytes from most jereditary pyropoikilocytosis (inherited hemolytic anemia) exhibit abnormalities in the alpha-spectrin gene. PMID: 18815189
- exon 1' and intron 1' are excellent candidate regions for mutations in patients with spectrin-linked hemolytic anemia PMID: 19008453
- The L49F mutation in alpha erythroid spectrin leads to an unstable triple helical bundle of alpha beta-spectrin partial domains, and thus unstable tetramers. PMID: 19593814