Recombinant Human Syntaxin-17 (STX17) Protein (His)

Name: Recombinant Human Syntaxin-17 (STX17) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07937P
Price: 299.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Price Save $2,266

Size

100ug

Product Overview

Description	Recombinant Human Syntaxin-17 (STX17) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P56962
Target Symbol	STX17
Species	Homo sapiens (Human)
Expression System	in vitro E.coli expression system
Tag	N-10His
Target Protein Sequence	SEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQKMMEKLTSSCPDLPSQTDKKCS
Expression Range	2-302aa
Protein Length	Full Length of Mature Protein
Mol. Weight	34.8 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. STX17 is a SNARE of the autophagosome involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. May also play a role in the early secretory pathway where it may maintain the architecture of the endoplasmic reticulum-Golgi intermediate compartment/ERGIC and Golgi and/or regulate transport between the endoplasmic reticulum, the ERGIC and the Golgi.
Subcellular Location	Endoplasmic reticulum membrane; Multi-pass membrane protein. Smooth endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein. Cytoplasm, cytosol.
Protein Families	Syntaxin family
Database References	HGNC: 11432 OMIM: 604204 KEGG: hsa:55014 STRING: 9606.ENSP00000259400 UniGene: Hs.704031

Gene Functions References

MALAT1 modulates the autophagy of retinoblastoma cell through miR-124-mediated stx17 regulation. PMID: 29073720
L. pneumophila Lpg1137 can shut down ER-mitochondria communication through cleavage of syntaxin 17 PMID: 28504273
STX17 is targeted specifically to LC3 positive autophagosome membranes. STX17 interacts with LC3 and GABARAP and has binding sites for LC3 at aa 172-175 (LC3-Interaction Region 1 [LIR1]) and aa 189-192 (LIR2). PMID: 29420192
SNARE priming, as exemplified by Syntaxin-17, is essential for maturation of autophagosomes but not for their formation. PMID: 29138318
Data suggest that accumulation of autophagosomes confers cytotoxicity in a number of cell types including neurons mimicking neurodegeneration; RNA interference of combinations of MTOR, VPS33A, and STX17 lead to accumulation of autophagosomes and cytotoxicity. (MTOR = mechanistic target of rapamycin kinase; VPS33A = vacuolar protein sorting 33A; STX17 = syntaxin 17) PMID: 28673965
Pacer recruits PI3KC3 and HOPS complexes to the autophagosome for their site-specific activation by anchoring to the autophagosomal SNARE Stx17. PMID: 28306502
This study demonstrates that the amount of syntaxin 17 decreased in Hepatitis C Virus replicating cells. In addition, syntaxin 17 is identified to be a novel factor controlling the release of HCV, and the relevance of autophagosome-lysosome fusion as a regulator of the amount of released viral particles is revealed. PMID: 27099307
Syn17 acts as a switch that responds to nutrient conditions and integrates functions for the endoplasmic reticulum and autophagosomes with mitochondrial dynamics PMID: 25619926
the homotypic fusion and protein sorting-tethering complex promotes autophagosome-lysosome fusion through interaction with STX17 PMID: 24554770
Study identifies syntaxin 17 (Stx17) as the autophagosomal SNARE required for fusion with the endosome/lysosome. PMID: 23217709
The syntaxin 17 is essential for maintaining the architecture of ERGIC and Golgi. PMID: 21545355
Common variants in the STX17 gene region do not play a key role in the pathogenesis of human melanoma. PMID: 19209086

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.