Recombinant Human Tissue Factor Pathway Inhibitor (TFPI) Protein (His), Active

Name: Recombinant Human Tissue Factor Pathway Inhibitor (TFPI) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05765P
Price: 349.0 USD
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized Human TFPI at 1 μg/ml can bind Anti-TFPI recombinant antibody , the EC 50 is 1.242-1.788 ng/mL. Biological Activity Assay

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - active proteins, Recombinant proteins holiday sale

Price Save $58

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tissue Factor Pathway Inhibitor (TFPI) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized Human TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody , the EC 50 is 1.242-1.788 ng/mL.
Uniprotkb	P10646
Target Symbol	TFPI
Synonyms	(TFPI)(Extrinsic pathway inhibitor)(EPI)(Lipoprotein-associated coagulation inhibitor)(LACI)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-10His
Target Protein Sequence	DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
Expression Range	29-282aa
Protein Length	Partial
Mol. Weight	31.9 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Subcellular Location	[Isoform Alpha]: Secreted.; [Isoform Beta]: Microsome membrane; Lipid-anchor, GPI-anchor.
Database References	HGNC: 11760 OMIM: 152310 KEGG: hsa:7035 STRING: 9606.ENSP00000233156 UniGene: Hs.516578
Tissue Specificity	Mostly in endothelial cells.

Gene Functions References

plasma level not different between pre-eclampsia and normal pregnancy PMID: 28521572
Patients with early onset preeclampsia are characterised by an attenuated coagulation response characterised by reduced thrombin generation stimulated by low-dose TF and elevated plasma TFPI activity. PMID: 28569919
Developed functional protein S assays that measure both the activated protein C- and TFPI-cofactor activities of protein S in plasma, which are hardly if at all affected by the FV Leiden mutation. PMID: 28211163
These data indicate that both isoforms of TFPI are present in advanced plaques and that anti-inflammatory M2 macrophages may be a potential source of TFPI. PMID: 28482260
Among the various candidate genes involved in acute rejection, CD47 inhibits monocyte/macrophage-mediated phagocytosis by identifying the CD47 signal regulatory protein alpha (SIRP-alpha) as self/non-self. Tissue factor pathway inhibitor (TFPI) is involved in the regulation of the coagulation pathway and is able to bind to another ligand of CD47, thrombospondin-1 (TSP-1). PMID: 28393401
Tissue Factor Pathway Inhibitor Gene Polymorphism is associated with response to therapy in Colorectal Cancer. PMID: 26968713
For the first time, we show that a TFPI variant is significantly associated with fibrinogen levels and risk of coronary artery disease. PMID: 28894953
miR-27a/b and miR-494 regulate TFPIalpha expression; there may be a role of these miRNAs in the estrogen-mediated downregulation of TFPIalpha PMID: 26999003
Genetic variations of the TFPI genes seem to be related with coronary artery disease, which likely cooperate with metabolic risk factor (diabetes mellitus) and play critical roles in the pathogenesis of coronary artery disease in Han Chinese. PMID: 28716011
Cleavage of FV at Arg(1545) , which abolishes the anticoagulant properties of FV and commits FV to the procoagulant pathway, is inhibited by binding of the TFPIalpha C-terminus to the FV acidic region PMID: 27801970
The aim of this study was to evaluate the concentration of TF and its inhibitor TFPI in blood plasma, the impact of traditional and non-traditional cardiovascular risk factors on their concentration and the impact of both markers of haemostasis on the severity of subclinical atherosclerosis. PMID: 28749986
The results show that cholesterol crystals induce TFPI and cytokine expression in M2-polarized macrophages through activation of the endoplasmic reticulum stress pathway and that TFPI has a protective effect against TNF-alpha and IL-6 mediated inflammation. PMID: 28712870
Among high-risk women, the tissue factor pathway inhibitor activity of patients with gestational vascular complications is higher than that in other patients. Hence, these markers could augment a screening strategy. PMID: 28328938
TFPI single nucleotide polymorphism is associated with venous thromboembolism. PMID: 28421636
a concentration of tissue factor pathway inhibitor was significantly lower in patients with essential thrombocythemia with JAK2 V617F mutation as compared with patients without the mutation PMID: 26945263
This review presents a comprehensive understanding of TFPI structure, biochemistry, and cellular expression which is necessary to understand how it modulates bleeding in hemophilia and the physiological impact of therapeutic agents targeting TFPI. PMID: 27207418
the main finding of the current study is the remarkable elevation in the plasma levels of both total and free TFPI in septic patients at baseline. The levels of both forms of the inhibitor remained elevated throughout the first 24 h with further elevation after enoxaparin administration. PMID: 26377606
TFPI-1 was a valuable predictor of deep venous thrombosis and tumor metastasis in non-small cell lung cancer patients. PMID: 28246607
Circulating FVII, FVIIa and TFPI were significantly elevated in women with severe preeclampsia in the absence of comparable changes in plasma TF levels. PMID: 26765308
HIF-1alpha is involved in the transcriptional regulation of the TFPI gene, and suggests that a hypoxic microenvironment inside a breast tumor may induce a procoagulant state in breast cancer patients. PMID: 26598923
ERalpha can interact with all three ERE half-sites in the TFPI 5'-flanking region. PMID: 26999742
rs5940 and rs7586970 moderate TFPI plasma levels and are candidate risk factors for thrombosis, but the regulation of TFPI plasma levels involves genetic factors beyond the TFPI gene. Review. PMID: 25879386
Tissue factor pathway inhibitor activity and APC resistance are related to coronary heart disease risk in women, but may not explain the increased CHD risk due to estrogen plus progestin therapy. PMID: 26681757
Association between genetic polymorphisms and deep vein thrombosis in a Chinese population. PMID: 26233570
coagulation system, TFPI play an important role in the pathogenesis of CRSwNP. PMID: 26163243
A significant degradation of TFPI was induced by ROS exposure, resulting in a decreased ability to bind FXa. ROS induce a procoagulant state in endothelial cells by altering TFPI structure, resulting in inhibition of TFPI binding to Factor Xa PMID: 25712553
TNFalpha and Stx-1 compared to TNFalpha alone leads to an increase in procoagulant TF on endothelial cells, which is explained by a significant decrease in TFPI not co-localized with TF and not to an increase in TF not co-localized with TFPI PMID: 25864889
Direct inhibition of FXa by TFPIalpha inhibits thrombin generation and contributes to the downregulation of coagulation. PMID: 25348176
Tissue factor pathway inhibitor-2 gene polymorphisms were associated with coronary atherosclerosis in the Chinese population PMID: 26496276
This study indicates that genetic and phenotypic variation of both TFPIalpha and TFPIbeta, more than TF, are markers of cancer progression. PMID: 25882602
Syndecan-3 and TFPI colocalize on the surface of endothelial-, smooth muscle-, and cancer cells PMID: 25617766
Describe inhibition of tissue factor:factor VIIa-catalyzed factor IX and factor X activation by TFPI and TFPI constructs. PMID: 25163770
Neither genetic polymorphisms nor the plasma levels of TFPI seem to act as direct risk factors for venous thromboembolism. PMID: 24448154
Thrombin decreases TFPI expression in human pleural mesothelial cells. PMID: 25303460
Colon TFPI levels are increased in ulcerative colitis. PMID: 24966616
TFPI inhibits lectin pathway of complement activation by direct interaction with MASP-2. PMID: 25359215
Most capillary endothelial cells of the cholecystitis group presented weak expression for TFPI. PMID: 24716194
TFPI is an early biomarker in myocardial infarct and may explain the final infarct size. PMID: 24461489
genetic polymorphism affects endogenous thrombin potential among FV Leiden carriers PMID: 24226152
Data indicate that the protein S sex hormone-binding globulin (SHBG)-like domain was important for binding and enhancement of tissue factor pathway inhibitor (TFPI). PMID: 24740810
Studies indicate differential expression of tissue factor pathway inhibitor isoforms TFPIalpha and TFPIbeta in platelets and endothelial cells. PMID: 24620349
TFPI mRNA expression was increased in clear cell carcinoma (P<0.01). PMID: 24094893
Both the protein S and the TFPI ratios were increased in patients with cirrhosis compared to controls. PMID: 23841464
Small peptides blocking inhibition of factor Xa and tissue factor-factor VIIa by tissue factor pathway inhibitor (TFPI). PMID: 24275667
Demonstrate a 5' untranslated region alternative splicing event that alters translation of TFPI isoforms produced via independent 3' splicing events within the same gene. PMID: 24233486
PS exerts anticoagulant cofactor activity with TFPIalpha from any physiological pool, likely by localizing TFPIalpha to membrane surfaces, stabilizing its interaction with membrane-bound FXa, and slowing thrombin generation. PMID: 24233490
Tissue factor pathway inhibitor-alpha inhibits prothrombinase during the initiation of blood coagulation. PMID: 24127605
The east Texas bleeding disorder-associated F5(A2440G) mutations leads to the formation of the TFPIalpha:FV-short complex, which inhibits activation and propagation of coagulation. PMID: 23979162
The effect of oral contraceptives on TFPI and PS is a possible explanation for the increased risk of venous thrombosis associated with oral contraceptives. PMID: 23407778
tissue factor pathway inhibitor has a role in coagulation in hemostasis, particularly when FVIII is missing PMID: 23348798

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.