Recombinant Human Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04728P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04728P
Regular price
$1,12000
$1,120.00
Sale price$29900
$299.00Save $821
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P29144 |
Target Symbol | TPP2 |
Synonyms | TPP2; Tripeptidyl-peptidase 2; TPP-2; EC 3.4.14.10; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase II; TPP-II |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | DTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH |
Expression Range | 44-264aa |
Protein Length | Partial |
Mol. Weight | 28.2 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited. Stimulates adipogenesis. |
Subcellular Location | Cytoplasm. Nucleus. Note=Translocates to the nucleus in responce to gamma-irradiation. |
Protein Families | Peptidase S8 family |
Database References |
Gene Functions References
- TPP2 mediates many important cellular functions by controlling ERK1 and ERK2 phosphorylation. PMID: 26041847
- Early-onset Evans syndrome, immunodeficiency, and premature immunosenescence associated with TPP2 deficiency have been described in two consanguineous siblings. PMID: 25414442
- Study found that autosomal recessive TPP2 mutations cause recurrent infections, autoimmunity, and neurodevelopmental delay in humans. PMID: 25525876
- TPPII, MYBBP1A and CDK2 form a protein-protein interaction network. PMID: 25303791
- Previously unknown differences between TPP II orthologues and subtilisin as well as features that might be conserved within the entire family of subtilisin-like serine peptidases. PMID: 22266401
- Study showed that overexpression of Tripeptidyl peptidase II (TPP2) occurs frequently during oral carcinogenesis and might be associated with the progression of Oral Squamous Cell Carcinoma (OSCC) via Spindle Assembly Checkpoint(SAC) activation. PMID: 22986808
- obtained a 3D structure of the human TPPII PMID: 22483107
- Current knowledge about TPPII with a focus on structural aspects. PMID: 21771670
- Results suggest an important function of TPPII in the maintenance of viral growth and may have implications for anti-viral therapy. PMID: 21134372
- the promoter could be localized to a 215 bp fragment upstream of the initiation codon. PMID: 15716107
- TPPII appears to promote malignant cell growth by allowing exit from mitosis and the survival of cells with severe mitotic spindle damage. PMID: 16762321
- TPP2 plays a specialized role in antigen processing and one that is not essential for the generation of most presented peptides. PMID: 16849449
- This investigation reveals that TPP II expression could be regulated through both positive and negative regulatory elements. PMID: 17343995
- Expression of mRNA for MuRF-1 increased approximately 3-fold at 10 days without changes in MAFbx or tripeptidyl peptidase II mRNA, but all decreased between 10 and 21 days of muscle disuse. PMID: 17901116
- Results indicate that TPPII is dispensable for the generation of proteasome-dependent HLA class I ligands and, the enzyme is not involved significantly in generating the proteasome-independent HLA-B27-bound peptide repertoire. PMID: 18286573
- Cross-presentation of NY-ESO-1/ISCOMATRIX cancer vaccine was proteasome independent and requires the cytosolic protease tripeptidyl peptidase II. PMID: 19155470
- MHC class I-restricted LMP1 epitopes studied in this work are two of very few epitopes known to date to be processed proteasome independently by tripeptidyl peptidase II. PMID: 19587004