Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 9 (TNFSF9) Protein (hFc-Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05788P
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 9 (TNFSF9) Protein (hFc-Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05788P
Regular price
$40700
$407.00
Sale price$29900
$299.00Save $108
/
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 9 (TNFSF9) Protein (hFc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2 μg/mL can bind TNFRSF9, the EC 50 is 2.671-3.702 ng/mL. |
Uniprotkb | P41273 |
Target Symbol | TNFSF9 |
Synonyms | (4-1BB ligand) (4-1BBL) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-hFc-Myc |
Target Protein Sequence | REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Expression Range | 71-254aa |
Protein Length | Partial |
Mol. Weight | 48.0 kDa |
Research Area | Cancer |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. |
Subcellular Location | Membrane; Single-pass type II membrane protein. |
Protein Families | Tumor necrosis factor family |
Database References | |
Tissue Specificity | Expressed in brain, placenta, lung, skeletal muscle and kidney. |
Gene Functions References
- CD137L-dendritic cells (CD137L-DCs) express high levels of adhesion molecules, display strong attachment. PMID: 27431276
- TNFSF9 exerts an inhibitory effect on hepatocellular carcinoma and may be a tumor suppressor. PMID: 28547807
- 4-1BB and 4-1BBL qualify as markers for prediction of patients' course and represent a valuable screening target for patients with acute myeloid leukemia at initial diagnosis. PMID: 27388616
- the results from this study show that the costimulatory 4-1BB ligand fortifies an antigen-rich melanoma cell line with enhanced antigen-specific stimulation of CD8 T cells PMID: 27564312
- the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated. PMID: 27430526
- blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation. PMID: 26872462
- CD137L is overexpressed in non-small cell lung cancer specimens and positive expression of CD137L was associated with better overall survival. PMID: 25631633
- In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells. PMID: 26125931
- vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer PMID: 25872647
- Elevated plasma levels and monocyte-associated expression of CD137 ligand in patients with acute atherothrombotic stroke PMID: 24899613
- Hence, the targeted combination of IL-15 and 4-BBL in the form of a trifunctional antibody-fusion protein is a promising new approach for cancer immunotherapy. PMID: 24198185
- monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline. PMID: 24639347
- TIRAP and IRAK2 are critical for the sustained inflammatory response that is mediated by late-phase signaling by the TLR-4-1BBL complex. PMID: 24084649
- this is the first study to indicate that this member of the TNF superfamily, CD137, is modulated by SAHA treatment in breast PMID: 22797667
- Data show that TNFR1 associates with CD137L and is required for CD137L reverse signaling. PMID: 23620528
- CD137L is a novel diagnostic marker of subtypes of non-Hodgkin B-cell lymphomas. PMID: 23095505
- signaling through CD137L in non-hematopoietic cells such as epithelial cells and endothelial cells has been shown to play an essential role in sterile inflammation by regulating immune cell recruitment. [Review] PMID: 22526397
- Stimulation of non-adherent PBMC with OVCAR-3 cells expressing 4-1BB ligand (4-1BBL) or IL-12 resulted in preferential expansion of the NK cell population. PMID: 22021067
- Data indicate that ex4-1BBL augments 4-1BB expression not only on the primed T cell, but also on DC. PMID: 21745658
- The expression of CD137L might play an important role in the development of laryngeal carcinomas. PMID: 20422976
- 4-1BBL and TRAF1 in the CD8 T cell response to influenza virus and HIV PMID: 21153322
- K562-MICA-4-1BBL-IL-15 cells would be developed for expansion of NK cells ex vivo and may have important implications for clinical immunotherapy. PMID: 20670353
- These data point to a hitherto unrecognized role of CD137 and CD137 ligand in multiple myeloma cell biology. PMID: 20520765
- TNFSF9 mRNA levels in peripheral blood mononuclear cells may be associated with primary biliary cirrhosis progression. PMID: 20303781
- Cocultures of Natural killer (NK) cells with CD137L transfectants confirmed that human CD137 inhibits NK-cell reactivity, while activating signals were transduced by its counterpart on NK cells in mice. PMID: 20008791
- the structure of the trimer of human 4-1BB ligand is unique among members of the tumor necrosis factor superfamily PMID: 20032458
- 4-1BBL and 4-1BB may have immunomodulatory functions, as shown by the anti-leukemia activity of MS-275 histone deacetylase inhibitor PMID: 19759901
- 4-1BBL provides a costimulatory signal for T cell activation, thereby allowing T cell expansion as well as cytokine production and the development of cytolytic effector function. PMID: 11994439
- Stimulation of 4-1BBL on DCs with 4-1BB-Fc or with 4-1BB-transfected Jurkat cells resulted in acquisition of capacity for the immature DCs to produce IL-12, suggesting that 4-1BBL may be an important mediator for maturation of CD11c(+) myeloid DCs PMID: 12590704
- 4-1 BB ligand can costimulate human CD28- T cells, resulting in cell division, inflammatory cytokine production, increased perforin levels, enhancement of cytolytic effector function, as well as the up-regulation of the anti-apoptotic protein Bcl-X(L). PMID: 12645943
- First evidence of expression and synthesis of CD137 and its ligand by human brain cells. PMID: 13130507
- Data show that reverse signaling via 4-1BB-ligand enhanced interleukin-12beta mRNA and the secretion of IL-12 p70 in various antigen-presenting cells, including monocytes. PMID: 14746806
- 4-1BB/4-1BBL and Fas/FasL pathways play important roles in vascular injury in Takayasu's arteritis. PMID: 14752253
- Data suggest that levels of soluble 4-1BB and 4-1BB ligand in sera at the time of diagnosis may be indicative of the severity and outcome of rheumatoid arthritis. PMID: 15031666
- trimeric CD137L (4-1BBL) requires cross-linking for its T cell co-stimulation activity PMID: 16204238
- Signaling through 4-1BB-L allows B cells to proliferate and the expression of its ligand, by the intra-tumoral mesh of follicular dendritic cells (FDC), could thus serve as a paracrine loop facilitating growth and survival of MCL cells PMID: 16287062
- Significantly lower CD137 ligand is associated with colorectal cancer patients PMID: 16596186
- Elevated plasma levels of 4-1BBL in multiple sclerosis patients may function as a self-regulatory mechanism of the 4-1BB/4-1BBL pathway involved in the disease process. PMID: 16970683
- Here we document a function for the TNF family member 4-1BB ligand (4-1BBL) in sustaining TLR-induced TNF production PMID: 17496895
- Reverse signalling by CD137 ligand is mediated by protein tyrosine kinases, p38 mitogen activated protein kinase (MAPK), extracellular signal-regulated kinase (ERK)1,2, MAP/ERK kinase (MEK), Phosphoinositide-3-kinase (PI3-K) and protein kinase A (PKA). PMID: 17855813
- selective immunosuppression through MSCs may perhaps occur partly through an increase in CD137L+ on T-lymphocytes PMID: 17972956
- T cells that had become non-responsive to anti-CD3 could be reactivated to proliferate when costimulated with 4-1BBL, either alone or combined with CD80/CD86. PMID: 17977894
- CD80 and 4-1BBL induce auto- and transcostimulation in tumor cells PMID: 18026115
- deliver new insights into the multiple effects of reverse signaling of CD137L in human DC during the initiation of an adaptive immune response PMID: 18395851
- PGE(2) induced the expression of the costimulatory molecules OX40L, CD70, and 4-1BBL on human dendritic cells. PMID: 19029446
- in cells costimulated with CD80/86 that had downregulated CD28 expression and ceased to proliferate, reactivation of proliferation by 4-1BBL costimulation also restored their CD28 expression PMID: 19217084
- (c)4-1BBL can be expressed on mononuclear blood cells in acute myeloid leukemia, myelodysplasia or non-Hodgkin lymphoma and can be coexpressed on lymphoid or myeloid malignant cells and on dendritic cells differentiated from AML-blasts. PMID: 19225975
- reverse signaling of 4-1BBL promotes the differentiation of potent T(h)1-inducing dendritic cells from human monocytes. PMID: 19684160