Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Protein (hFc), Active

Name: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Protein (hFc), Active
Brand: Beta LifeScience
SKU: BLC-05569P
Price: 349.0 USD
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized TNF-α at 5 μg/ml can bind human TNFR2, the EC 50 of human TNFR2 protein is 1.162-1.481 ng/ml. Biological Activity Assay

Activity Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B, the EC 50 is 1.632-2.699 ng/ml. Biological Activity Assay

Collections: Cytokines, Cytokines and growth factors, Recombinant proteins, Recombinant proteins fall special offers - active proteins, Recombinant proteins holiday sale, Tumor necrosis factors and receptors (tnfs)

Price Save $58

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized TNF-α at 5 μg/ml can bind human TNFR2, the EC 50 of human TNFR2 protein is 1.162-1.481 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B, the EC 50 is 1.632-2.699 ng/ml.
Uniprotkb	P20333
Target Symbol	TNFRSF1B
Synonyms	(Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD120b) (Etanercept) (TBP-2) (TBPII)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Expression Range	23-257aa
Protein Length	Partial
Mol. Weight	54.1 kDa
Research Area	Cancer
Form	Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Tumor necrosis factor-binding protein 2]: Secreted.
Database References	HGNC: 11917 OMIM: 191191 KEGG: hsa:7133 STRING: 9606.ENSP00000365435 UniGene: Hs.256278

Gene Functions References

TL1A modulated Rheumatoid arthritis-fibroblast-like synoviocytes migration and Indian hedgehog signaling pathway using TNFR2. PMID: 29748156
Data suggest that maternal glycemic response during pregnancy is associated with lower DNA methylation of 4 CpG sites within PDE4B gene in placenta (collected after normal-weight term birth); 3 additional CpG sites are differentially methylated relative to maternal glucose response within TNFRSF1B, LDLR, and BLM genes. (PDE4B = phosphodiesterase-4B; LDLR = low density lipoprotein receptor; BLM = Bloom syndrome protein) PMID: 29752424
serum level did not change after tonsillectomy alone but decreased significantly after steroid pulse therapy in patients with IgA nephropathy PMID: 28389814
Elevated serum TNFR2 may be a possible marker of COPD in asymptomatic smokers and ex-smokers. PMID: 28744116
TNFR2 promoted Adriamycin resistance in breast cancer cells by regulating the DNA damage repair. PMID: 28677724
Serum TNFR2 is a biomarker for patients with chronic kidney disease. PMID: 28667032
Data indicate activators of tumor necrosis factor receptor 2 (TNFR2) and a potential role for this target in immunotherapy. PMID: 27626702
In this study, we identified a novel association between ANCA levels, TNFRSF1B genotype and decreased circulating TNFR2 levels, which may be reflective of the underlying biological mechanisms that determine clinical expression and/or response to certain therapies. PMID: 27104820
In Han Chinese population of Hunan province, TNFRSF1B+676 gene polymorphisms are not associated with the genetic risk of rheumatoid arthritis PMID: 27640805
Results showed that TNFR2 was upregulated in papillary thyroid carcinoma tissues, and its expression is regulated by H19. PMID: 29287713
The TNFRSF1Brs3397 variant may play a role in modulating the risk of rheumatoid arthritis, but does not provide strong evidence of an impact of TNFRSF1B variants in determining response to anti-TNF drugs. PMID: 25850964
atopic dermatits patients had increased TNFR2 expression on immune cells PMID: 29212072
the blocking of tumor necrosis factor receptor 2 (TNFR2) decreased TL1A-stimulated IL-6 production by rheumatoid arthritis fibroblast-like synoviocytes. PMID: 27081759
Data suggest that, by targeting tumor cells and immunosuppressive tumor-associated Tregs, antagonistic tumor necrosis factor receptor 2 (TNFR2) antibodies may be an effective treatment for cancers positive for TNFR2. PMID: 28096513
p75 neurotrophin receptor (p75TNFR) was the first NGFR (nerve growth factor receptor) to be cloned and the founding member of the TNFR (tumor necrosis factor receptor) superfamily. However, data suggest that p75TNF is an atypical TNFR superfamily protein; p75TNFR forms dimers (activated by dimeric neurotrophins) that are structurally unrelated to TNFR superfamily proteins. [REVIEW] PMID: 28215307
High plasma levels of TNFR2 and TNFR1 were associated with incident intracerebral hemorrhage. PMID: 28830973
Serum TNFR2 levels were elevated in lupus nephritis patients versus controls. PMID: 27973968
Voxel-based morphometry was used to analyse the associations between TNFRSF1B (rs1061624) genotypes and grey matter structure. Analysis of the TNFRSF1B SNP rs1061624 yielded a significant association with hippocampal but not with striatal volume, whereby G homozygotes were associated with increased volumes relative to A homozygotes and heterozygotes. PMID: 27528091
Our results demonstrated that Treg frequencies and TNFR2 expression on Tregs are increased in sarcoidosis, followed by a decline during infliximab therapy, suggesting a pathophysiological role of this T cell subset. PMID: 27158798
identified 6 known and 4 novel variations in 6 different exons of TNFR2 gene; out of these identified variations, 5 known variations were found to be significantly associated with the risk of cervical cancer; postmenopausal women having CAAGC + CTGCC haplotypes in TNFR2 gene along with HPV infection and tobacco consumption may lead to the development of cervical cancer PMID: 27145290
LTbetaR is essential for efficient liver regeneration and cooperates with TNFRp55 in this process. Differences in survival kinetics strongly suggest distinct functions for these two cytokine receptors in liver regeneration. PMID: 26708145
that U87-p75(NTR) cells express higher levels of Cdh-11 protein and that siRNA-mediated knockdown of Cdh-11 resulted in a significant decrease in p75(NTR)-mediated glioblastoma cell migration PMID: 26476273
TNF-alpha/TNFR2 regulatory axis stimulates EphB2-mediated neuroregeneration via activation of NF-kappaB. PMID: 26492598
This meta-analysis demonstrates that TNFRSF1B T allele carriers show a better response to anti-TNF therapy--{REVIEW} PMID: 26071216
Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury. PMID: 26425877
NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid PMID: 26569118
our findings implicate TNFR2 in supporting myeloid-derived suppressor cells -mediated immune suppression and metastasis in the liver PMID: 26483205
In conclusion, we report a significant association between the TNFRSF1B p.M196R variant and the risk for psoriasis and the response to treatment with anti-TNF or anti-Il-12/Il-23. PMID: 25537528
Plasma sTNFR2 was higher during pregnancy compared with controls. Urinary levels of sTNFR2 were higher in preeclampsia and pregnant women compared with controls. PMID: 25034210
study suggests that TNFR2(+) Tregs play a role in promoting tumor progressive metastasis PMID: 26280204
Recurrent point mutations and genomic gains of TNFRSF1B, encoding the tumor necrosis factor receptor TNFR2, are present in a subset of patients with mycosis fungoides and Sezary syndrome. PMID: 26258847
Increased plasma level of sTNFRII is found to be associated with exudative age-related macular degeneration. PMID: 25363549
ADAM17 was identified as the protease responsible for TNFR2 shedding by CD8(+) T cells, with ADAM17 and TNFR2 required in "cis" for shedding to occur. PMID: 26019295
hTNFR2 blocks the biological activity of lymphotoxin beta. PMID: 25940088
NRH2 enhanced the ratio of Bax/Bcl-2 by promoting the expressions of proNGF, sortilin and p75NTR, thereby inducing brain cell apoptosis. PMID: 25854576
Only TNFR2 can induce TRAF2 degradation. PMID: 25152365
Data show that TNF-alpha receptor TNFR2 mRNA expression was significantly increased after 6, 9 and 12 hours of poly (I:C) stimulation. PMID: 25419735
Functional TNFR2 196 M/R polymorphism is associated with susceptibility to rheumatoid arthritis in the European population. PMID: 24777778
Serum TNFR2 is associated with renal decline and ESRD risk in type 1 diabetes and proteinuria. PMID: 24898299
The TNFRII nt587 G/G genotype may increase the risk of developing AS in the Chinese population. PMID: 25061744
High TNF receptor 2 is closely associated with the loss of kidney function. PMID: 24717758
Inflammation mediated through TNFalpha and its receptors, TNFR1 and TNFR2, may represent an important component of a comorbidity-induced inflammatory response that partially drives the pathophysiology of heart failure (HF) with preserved ejection fraction. PMID: 24923671
TNF-TNFR2 signaling may induce RBR in naive BM-EPCs and that blocking TNF-TNFR2 signaling may prevent delayed RBR in BM-EPCs, conceivably, in bone marrow milieu in general PMID: 24711449
Blood levels of CRP, IL-6 and TNFalpha-R2 are not associated with incident depression. PMID: 24836084
Addition of leukemia inhibitory factor (LIF) neutralizing antibodies inhibited oligodendrocyte differentiation, indicating a crucial role of TNFR2-induced astrocyte derived LIF for oligodendrocyte maturation PMID: 24310780
Higher plasma TNFR75 levels were associated with decreased time to first COPD exacerbatino in a prospective study. PMID: 24136332
Our results support a role of TNFRSF1B gene variants in the response to IFX in CD patients. PMID: 24121042
Serum TNFR2 expression levels might be a powerful prognostic factor for patients treated with the R-CHOP regimen. PMID: 23672298
Release of nonmuscle myosin II from the cytosolic domain of tumor necrosis factor receptor 2 is required for target gene expression. PMID: 23861542
genetic association studies in a population of women in Tunisia: Data suggest that an SNP in exon 6 of TNFR2/TNFRSF1B (rs1061622) is associated with pre-eclampsia. PMID: 23799986

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.