Recombinant Human Vasopressin V1B Receptor (AVPR1B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00402P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Vasopressin V1B Receptor (AVPR1B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00402P
Regular price
$2,86600
$2,866.00
Sale price$29900
$299.00Save $2,567
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Vasopressin V1B Receptor (AVPR1B) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P47901 |
Target Symbol | AVPR1B |
Species | Homo sapiens (Human) |
Expression System | in vitro E.coli expression system |
Tag | N-10His |
Target Protein Sequence | MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF |
Expression Range | 1-424aa |
Protein Length | Full Length |
Mol. Weight | 53.0 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, may recognize and internalize the complex formed by AVP/Arg-vasopressin, SARS-CoV-2 spike protein and secreted ACE2 through DNM2/dynamin 2-dependent endocytosis. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily |
Database References |
Gene Functions References
- Patients were different from those previously studied. We measured the expression of the pituitary-specific hormone genes and type 1 corticotrophin-releasing hormone and arginine vasopressin 1b receptors, by quantitative real-time polymerase chain reaction using TaqMan probes. PMID: 29979686
- Polymorphisms of CRHR1 and AVPR1b may modify susceptibility to mood disorders. PMID: 23962971
- The results suggest that the AVPR1B gene rs28373064 is linked to emotional empathy and prosociality. PMID: 26354157
- AA genotype of rs28418396 single-nucleotide polymorphism near the arginine vasopressin receptor 1b gene is associated with serious adverse events in patients with septic shock treated with vasopressin and norepinephrine. PMID: 24919159
- Genetic variance of arginine vasopressin receptor 1B(AVPR1B) contributes to overweight and data indicate a link between AVPR1B variance and diabetes mellitus development PMID: 26503846
- The association of AVPR1B G*A-haplotype (rs28632197 and rs33911258, respectively) and decreased Self-transcendence (TCI-125) was demonstrated in the total sample and in Udmurts. PMID: 25438555
- Participants carrying both GG/GA variant of AVPR1b rs28373064 and AA variant of clock rs6832769 showed highest scores on the Emotional prosocial tendency measure. the clock gene and OXT/AVP systems are intertwined and contribute to human prosociality. PMID: 25309987
- The associations of the AVP 1B receptor may be specific to reactive, emotional rather than proactive or callous types of aggression. PMID: 24842238
- association between polymorphisms of AVPR1b gene and psychotic dimension.possible involvement of the AVPR1b gene in the etiology of psychotic features in the course of affective disorders PMID: 24012103
- AVPR1B genetic variation has a role in suicide attempt etiology characterized by elevated depression levels. PMID: 23422793
- The results of thi study showed that no association was found for alleles, genotypes, or haplotype analysis for AVPR1b genes and melancholic depression. PMID: 23068076
- This is the first report of a genetic association between vasopressin receptor 1B and child aggression. PMID: 22910476
- polymorphism rs28536160 genotype TT of the AVPR1b gene may increase susceptibility for obtaining psychotic features in the course of bipolar disorder I. PMID: 22341483
- the presence of V1b receptors also found in human Langerhans islets could suggest hormonal control of AVP in human pancreas. PMID: 12736162
- Data supports a protective effect of this major haplotype for recurrent major depression. PMID: 15094789
- determination of a C-terminal motif required for export to plasma membrane PMID: 15528211
- V1bR and CRHR1 can form constitutive homo- and heterodimers. PMID: 17318384
- study found evidence to implicate the AVPR1B gene in the etiology of mood disorders, particularly in females PMID: 17909131
- polymorphisms in the AVPR1B and the CRHR1 genes alter the susceptibility to panic disorder PMID: 18384079
- AVPR1B is associated with autistic traits, empathy, and Asperger syndrome. PMID: 19598235
- An association analysis with AVPR1b single-nucleotide polymorphism for attention deficit hyperactivity disorder, was performed in a patient/control sample. PMID: 19668115