Recombinant Lama Glama Interleukin-2 (IL2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06764P
Greater than 90% as determined by SDS-PAGE.
Recombinant Lama Glama Interleukin-2 (IL2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06764P
Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines, Cytokines and growth factors, Interleukins and receptors, Recombinant interleukin-2 (il-2) proteins, Recombinant proteins, Recombinant proteins fall special offers, Recombinant proteins fall special offers - full-length proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Lama Glama Interleukin-2 (IL2) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q865X2 |
Target Symbol | IL2 |
Species | Lama glama (Llama) |
Expression System | Yeast |
Tag | C-6His |
Target Protein Sequence | APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT |
Expression Range | 21-154aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 17.0 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. |
Subcellular Location | Secreted. |
Protein Families | IL-2 family |