Recombinant Mouse Mast Cell Tryptase Protein (His tag)

Name: Recombinant Mouse Mast Cell Tryptase Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-9953P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	Q02844
Synonym	alpha II Lung tryptase Mast cell alpha II tryptase Mast cell beta I tryptase Mast cell protease 7 Mast cell protease II MCP 7 Pituitary tryptase Skin tryptase TPS 1 TPS1 TPS2 TPSAB1 TPSAB1 protein TPSB1 Tryptase 1 Tryptase alpha 1 tryptase alpha I included Tryptase alpha II tryptase alpha II included tryptase alpha included tryptase alpha/beta 1 Tryptase beta 1 tryptase beta I included Tryptase I tryptase I included Tryptase III Tryptase skin
Description	Recombinant Mouse Mast Cell Tryptase Protein (His tag) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	AHGNKWPWQVSLRANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNKV RVQLRKQYLYYHDHLMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDY VHPVPLPPASETFPSGTLCWVTGWGNIDNGVNLPPPFPLKEVQVPIIENH LCDLKYHKGLITGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTW LQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHH
Molecular Weight	30 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity.
Protein Families	Peptidase S1 family, Tryptase subfamily
Database References	KEGG: mmu:100503895 STRING: 10090.ENSMUSP00000120741 UniGene: Mm.3301

Gene Functions References

transcriptional activation of mouse mast cell Protease-7 by activin and transforming growth factor-beta is inhibited by microphthalmia-associated transcription factor PMID: 14527958
Because mMCP-6 and mMCP-7 can compensate for each other in this mouse disease model, the elimination of both tryptases is necessary to reveal the prominent roles of these serine proteases in joint inflammation and destruction. PMID: 18668540
TGF-beta stimulates mmcp-7 transcription through the Smad3-Smad4 pathway as well as c-fos induction PMID: 16730810

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.