Recombinant Mouse MESDC2 Protein
Beta LifeScience
SKU/CAT #: BLA-9957P
Recombinant Mouse MESDC2 Protein
Beta LifeScience
SKU/CAT #: BLA-9957P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9ERE7 |
Synonym | BOCA KIAA0081 LDLR chaperone MESD MESD MESD_HUMAN MESDC 2 mesdc2 Mesoderm development candidate 2 Mesoderm development protein Renal carcinoma antigen NY REN 61 Renal carcinoma antigen NY-REN-61 |
Description | Recombinant Mouse MESDC2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSADTPGEATPPPRKKKDIRDYNDADMAR LLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLM MFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGS YAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDP KPRASKEDNRAGSRREDL |
Molecular Weight | 24 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |